SDS-Page
Protein K3 Recombinant Protein | VACWR034 recombinant protein
Recombinant Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) Protein K3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein K3; Recombinant Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) Protein K3; Protein K2; VACWR034 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-88
Sequence
MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ
Sequence Length
88
Species
Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-Page
SDS-Page
Related Product Information for VACWR034 recombinant protein
Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff.
References
"Non-essential genes in the vaccinia virus HindIII K fragment: a gene related to serine protease inhibitors and a gene related to the 37K vaccinia virus major envelope antigen."
Boursnell M.E.G., Foulds I.J., Campbell J.I., Binns M.M.
J. Gen. Virol. 69:2995-3003(1988)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
26.55kD
NCBI Official Full Name
interferon resistance protein
NCBI Official Symbol
K3L
NCBI Protein Information
interferon resistance protein
UniProt Protein Name
Protein K3
Protein Family
UniProt Gene Name
VACWR034
UniProt Entry Name
K3_VACCW
Uniprot Description
Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff.
Research Articles on VACWR034
Similar Products
Product Notes
The VACWR034 vacwr034 (Catalog #AAA969675) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-88. The amino acid sequence is listed below: MLAFCYSLPN AGDVIKGRVY EKDYALYIYL FDYPHFEAIL AESVKMHMDR YVEYRDKLVG KTVKVKVIRV DYTKGYIDVN YKRMCRHQ. It is sometimes possible for the material contained within the vial of "Protein K3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
