V-type proton ATPase 16 kDa proteolipid subunit (AAEL000291) Recombinant Protein | AaeL_AAEL000291 recombinant protein
Recombinant Aedes aegypti V-type proton ATPase 16 kDa proteolipid subunit (AAEL000291)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
V-type proton ATPase 16 kDa proteolipid subunit (AAEL000291); Recombinant Aedes aegypti V-type proton ATPase 16 kDa proteolipid subunit (AAEL000291); Recombinant V-type proton ATPase 16 kDa proteolipid subunit (AAEL000291); V-type proton ATPase 16 kDa proteolipid subunit; V-ATPase 16 kDa proteolipid subunit; V-ATPase subunit C Vacuolar proton pump 16 kDa proteolipid subunit; AaeL_AAEL000291 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-157
Sequence
MALPEENPVYGPFFGVMGAAAAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAGSLDTPTKYSLYKGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVAIYLYTK
Sequence Length
157
Species
Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
16,045 Da
NCBI Official Full Name
Vacuolar ATP synthase 16 kDa proteolipid subunit
NCBI Official Symbol
AaeL_AAEL000291
NCBI Protein Information
Vacuolar ATP synthase 16 kDa proteolipid subunit
UniProt Protein Name
V-type proton ATPase 16 kDa proteolipid subunit
UniProt Gene Name
V-ATPase 16 kDa proteolipid subunit
UniProt Synonym Gene Names
V-ATPase 16 kDa proteolipid subunit
UniProt Entry Name
VATL_AEDAE
Uniprot Description
Function: Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Subunit structure: V-ATPase is a heteromultimeric enzyme composed of a peripheral catalytic V1 complex (main components: subunits A, B, C, D, E, and F) attached to an integral membrane V0 proton pore complex (main component: the proteolipid protein; which is present as a hexamer that forms the proton-conducting pore).
Subcellular location: Vacuole membrane; Multi-pass membrane protein.
Sequence similarities: Belongs to the V-ATPase proteolipid subunit family.
Similar Products
Product Notes
The AaeL_AAEL000291 v-atpase 16 kda proteolipid subunit (Catalog #AAA1247545) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-157. The amino acid sequence is listed below: MALPEENPVY GPFFGVMGAA AAIIFSALGA AYGTAKSGTG IAAMSVMRPE LIMKSIIPVV MAGIIAIYGL VVAVLIAGSL DTPTKYSLYK GFIHLGAGLA VGFSGLAAGF AIGIVGDAGV RGTAQQPRLF VGMILILIFA EVLGLYGLIV AIYLYTK. It is sometimes possible for the material contained within the vial of "V-type proton ATPase 16 kDa proteolipid subunit (AAEL000291), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
