Glycoprotein gp2 (US4) Recombinant Protein | US4 recombinant protein
Recombinant Equine herpesvirus 1 Glycoprotein gp2 (US4)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glycoprotein gp2 (US4); Recombinant Equine herpesvirus 1 Glycoprotein gp2 (US4); Recombinant Glycoprotein gp2 (US4); Glycoprotein gp2; Glycoprotein X; GpX; US4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
26-383
Sequence
TETTTSSSSTSGSGQSTSSGTTNSSSSPTTSPPTTSSSPPTSTHTSSPSTANAQKHAGHHRGRAGGRRGSPQGGSHTTPHPDRLTPSPDDTYDDDTNHPNGRNNSIEIVPQLPPDRPIIELGVATLRKNFMEASCTVETNSDLAIFWKIGKPSVDAFNRGTTHTRLMRNGVPVYALVSTLRVPWLNVIPLTKITCAACPTNLVAGDGVDLNSCTTKSTTIPCPGQQRTHIFFSAKGDRAVCITSELVSQPTITWSVGSDRLRNDGFSQTWYGIQPGVCGILRSEVRIHRTTWRFGSTSKDYLCEVSASDSKTSDYKVLPNAHSTSNFALVAATTLTVTILCLLCCLYCMLTRPRASVY
Sequence Length
383
Species
Equine herpesvirus 1 (strain Kentucky A) (EHV-1) (Equine abortion virus)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
Uniprot Description
Function: The glycoprotein gp2 from the avirulent strain Kentucky A (KyA) is probably non functional since this strain harbors an in-frame deletion of 1,242 nucleotides in gene 71.
Subcellular location: Virion membrane; Single-pass membrane protein
Potential.
Similar Products
Product Notes
The Glycoprotein gp2 (US4) us4 (Catalog #AAA1183791) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-383. The amino acid sequence is listed below: TETTTSSSST SGSGQSTSSG TTNSSSSPTT SPPTTSSSPP TSTHTSSPST ANAQKHAGHH RGRAGGRRGS PQGGSHTTPH PDRLTPSPDD TYDDDTNHPN GRNNSIEIVP QLPPDRPIIE LGVATLRKNF MEASCTVETN SDLAIFWKIG KPSVDAFNRG TTHTRLMRNG VPVYALVSTL RVPWLNVIPL TKITCAACPT NLVAGDGVDL NSCTTKSTTI PCPGQQRTHI FFSAKGDRAV CITSELVSQP TITWSVGSDR LRNDGFSQTW YGIQPGVCGI LRSEVRIHRT TWRFGSTSKD YLCEVSASDS KTSDYKVLPN AHSTSNFALV AATTLTVTIL CLLCCLYCML TRPRASVY. It is sometimes possible for the material contained within the vial of "Glycoprotein gp2 (US4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
