Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Urease accessory protein UreD 1 (ureD1) Recombinant Protein | ureD3 recombinant protein

Recombinant Streptomyces griseus subsp. griseus Urease accessory protein UreD 1 (ureD1)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Urease accessory protein UreD 1 (ureD1); Recombinant Streptomyces griseus subsp. griseus Urease accessory protein UreD 1 (ureD1); Recombinant Urease accessory protein UreD 1 (ureD1); Urease accessory protein UreD 1; ureD3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-255aa; full length protein
Sequence
MTGPPAPAARPAEPDDPTVVAVERDASGRHLARELSPGAFLAPRPLLPCADRLRIALVGT RAGLLAGDDLRLHVSVGPGARLDLVEPSGLVAYDHRGGRSAWRARIDIAAGGRLDWDGKP FVVAHGAWVDRTMEVTLAPGARMLWRDTLVLGRSGERGGRVRTRTRAEYDGRELLVEDLD LTDPDIRELPGVLGPNRIVGSVTALGTRPPGPPHPYRTDLAGPGAQVRLLDTEAPAMEAE LSALCEHWRTENDHA
Sequence Length
255
Species
Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,376 Da
NCBI Official Full Name
urease accessory protein
NCBI Official Symbol
ureD3
NCBI Protein Information
urease accessory protein
UniProt Protein Name
Urease accessory protein UreD 1
Protein Family
UniProt Gene Name
ureD1
UniProt Entry Name
URED1_STRGG

Uniprot Description

Function: Required for maturation of urease via the functional incorporation of the urease nickel metallocenter

By similarity. HAMAP-Rule MF_01384

Subunit structure: UreD, UreF and UreG form a complex that acts as a GTP-hydrolysis-dependent molecular chaperone, activating the urease apoprotein by helping to assemble the nickel containing metallocenter of UreC. The UreE protein probably delivers the nickel

By similarity.

Subcellular location: Cytoplasm

By similarity HAMAP-Rule MF_01384.

Sequence similarities: Belongs to the UreD family.

Similar Products

Product Notes

The ureD3 ured1 (Catalog #AAA1119270) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-255aa; full length protein. The amino acid sequence is listed below: MTGPPAPAAR PAEPDDPTVV AVERDASGRH LARELSPGAF LAPRPLLPCA DRLRIALVGT RAGLLAGDDL RLHVSVGPGA RLDLVEPSGL VAYDHRGGRS AWRARIDIAA GGRLDWDGKP FVVAHGAWVD RTMEVTLAPG ARMLWRDTLV LGRSGERGGR VRTRTRAEYD GRELLVEDLD LTDPDIRELP GVLGPNRIVG SVTALGTRPP GPPHPYRTDL AGPGAQVRLL DTEAPAMEAE LSALCEHWRT ENDHA. It is sometimes possible for the material contained within the vial of "Urease accessory protein UreD 1 (ureD1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.