UPF0283 membrane protein YpAngola_A2532 (YpAngola_A2532) Recombinant Protein | YpAngola_A2532 recombinant protein
Recombinant Yersinia pestis bv. Antiqua UPF0283 membrane protein YpAngola_A2532 (YpAngola_A2532)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
UPF0283 membrane protein YpAngola_A2532 (YpAngola_A2532); Recombinant Yersinia pestis bv. Antiqua UPF0283 membrane protein YpAngola_A2532 (YpAngola_A2532); Recombinant UPF0283 membrane protein YpAngola_A2532 (YpAngola_A2532); UPF0283 membrane protein YpAngola_A2532; YpAngola_A2532 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-353
Sequence
MSEPLKPRIDFEQPLQSLDEPVLKSAQAFDEQAAEKFYPAAPELDAEDEEGRVEGLVNAALKPKRSLWRKMVTAGMVILGASVIAQSVQWVNQAWQQQDWIALGATTAGGLIILAGVGSVVTEWRRLYHLRQRAEERDIARALLVSHGVGQGRVFCEKLARQAGLDQGHPALQRWQASLHETHNDREVVELYAKLVQPALDNQARAEISRYAAESALMIAVSPLALVDMAFIAWRNIRLINRIAALYGIELGYFSRIRLFRLVLLNIAFAGASELVREVGMDWLSQDLAARLSARAAQGIGAGLLTARLGIKAMELCRPLPWLEGDKPKLGDFRRQLMNQLKNTLPKKDKTAH
Sequence Length
353
Species
Yersinia pestis bv. Antiqua (strain Angola)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,264 Da
NCBI Official Full Name
hypothetical protein YpAngola_A2532
NCBI Official Symbol
YpAngola_A2532
NCBI Protein Information
hypothetical protein
UniProt Protein Name
UPF0283 membrane protein YpAngola_A2532
Protein Family
UniProt Entry Name
Y2532_YERPG
Uniprot Description
Subcellular location: Cell inner membrane; Multi-pass membrane protein
By similarity HAMAP-Rule MF_01085.
Sequence similarities: Belongs to the UPF0283 family.
Similar Products
Product Notes
The YpAngola_A2532 (Catalog #AAA1195898) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-353. The amino acid sequence is listed below: MSEPLKPRID FEQPLQSLDE PVLKSAQAFD EQAAEKFYPA APELDAEDEE GRVEGLVNAA LKPKRSLWRK MVTAGMVILG ASVIAQSVQW VNQAWQQQDW IALGATTAGG LIILAGVGSV VTEWRRLYHL RQRAEERDIA RALLVSHGVG QGRVFCEKLA RQAGLDQGHP ALQRWQASLH ETHNDREVVE LYAKLVQPAL DNQARAEISR YAAESALMIA VSPLALVDMA FIAWRNIRLI NRIAALYGIE LGYFSRIRLF RLVLLNIAFA GASELVREVG MDWLSQDLAA RLSARAAQGI GAGLLTARLG IKAMELCRPL PWLEGDKPKL GDFRRQLMNQ LKNTLPKKDK TAH. It is sometimes possible for the material contained within the vial of "UPF0283 membrane protein YpAngola_A2532 (YpAngola_A2532), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
