UPF0154 protein UPA3_0273 (UPA3_0273) Recombinant Protein | UPA3_0273 recombinant protein
Recombinant Ureaplasma parvum serovar 3 UPF0154 protein UPA3_0273 (UPA3_0273)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
UPF0154 protein UPA3_0273 (UPA3_0273); Recombinant Ureaplasma parvum serovar 3 UPF0154 protein UPA3_0273 (UPA3_0273); Recombinant UPF0154 protein UPA3_0273 (UPA3_0273); UPF0154 protein UPA3_0273; UPA3_0273 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-109
Sequence
MNFSSFIFKVSDVFKSVIHEASDVVTKADLDNANAHTHSLAVGLGIGIVLFLIAGLIIGYFISMKIMKRQLKKNPPISKDTIRMIYQQVGRKPSESQINEIYNRAVKQK
Sequence Length
109
Species
Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,223 Da
NCBI Official Full Name
hypothetical protein UPA3_0273
NCBI Official Symbol
UPA3_0273
NCBI Protein Information
hypothetical protein
UniProt Protein Name
UPF0154 protein UPA3_0273
Protein Family
UniProt Entry Name
Y273_UREP2
Uniprot Description
Subcellular location: Cell membrane; Single-pass membrane protein
Potential HAMAP-Rule MF_00363.
Sequence similarities: Belongs to the UPF0154 family.
Similar Products
Product Notes
The UPA3_0273 (Catalog #AAA1200481) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-109. The amino acid sequence is listed below: MNFSSFIFKV SDVFKSVIHE ASDVVTKADL DNANAHTHSL AVGLGIGIVL FLIAGLIIGY FISMKIMKRQ LKKNPPISKD TIRMIYQQVG RKPSESQINE IYNRAVKQK. It is sometimes possible for the material contained within the vial of "UPF0154 protein UPA3_0273 (UPA3_0273), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
