Transcription factor UPBEAT1 (UPB1) Recombinant Protein | UPB1 recombinant protein
Recombinant Arabidopsis thaliana Transcription factor UPBEAT1 (UPB1)
Gene Names
UPB1; T8I13.11; UPBEAT1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transcription factor UPBEAT1 (UPB1); Recombinant Arabidopsis thaliana Transcription factor UPBEAT1 (UPB1); UPB1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-102, Full length protein
Sequence
MGVTLEGQRKESIWVLMRRQRARRALVKKIMIRPRKSVEASRRPCRAIHRRVKTLKELVPNTKTSEGLDGLFRQTADYILALEMKVKVMQTMVQVLTETNCV
Sequence Length
102
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
11,879 Da
NCBI Official Full Name
transcription factor UPBEAT protein
NCBI Official Symbol
UPB1
NCBI Official Synonym Symbols
T8I13.11; UPBEAT1
NCBI Protein Information
transcription factor UPBEAT protein
UniProt Protein Name
Transcription factor UPBEAT1
Protein Family
UniProt Gene Name
UPB1
UniProt Synonym Gene Names
BHLH151; EN146; AtbHLH151; bHLH 151
NCBI Description
Encodes UPBEAT1 (UPB1), a transcription factor with a bHLH domain. Regulates the expression of a set of peroxidases that modulate the balance of reactive oxygen species (ROS) between the zones of cell proliferation and the zone of cell elongation where differentiation begins. Disruption of UPB1 activity alters this ROS balance, leading to a delay in the onset of differentiation.
Uniprot Description
Transcription factor that modulates the balance between cellular proliferation and differentiation in root growth. Does not act through cytokinin and auxin signaling, but by repressing peroxidase expression in the elongation zone.
Research Articles on UPB1
Similar Products
Product Notes
The UPB1 upb1 (Catalog #AAA1109412) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-102, Full length protein. The amino acid sequence is listed below: MGVTLEGQRK ESIWVLMRRQ RARRALVKKI MIRPRKSVEA SRRPCRAIHR RVKTLKELVP NTKTSEGLDG LFRQTADYIL ALEMKVKVMQ TMVQVLTETN CV. It is sometimes possible for the material contained within the vial of "Transcription factor UPBEAT1 (UPB1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
