Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein UNUSUAL FLORAL ORGANS (UFO) Recombinant Protein | UFO recombinant protein

Recombinant Arabidopsis thaliana Protein UNUSUAL FLORAL ORGANS (UFO)

Gene Names
UFO; F17F8.16; UNUSUAL FLORAL ORGANS
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein UNUSUAL FLORAL ORGANS (UFO); Recombinant Arabidopsis thaliana Protein UNUSUAL FLORAL ORGANS (UFO); UFO recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-442, Full length protein
Sequence
MDSTVFINNPSLTLPFSYTFTSSSNSSTTTSTTTDSSSGQWMDGRIWSKLPPPLLDRVIAFLPPPAFFRTRCVCKRFYSLLFSNTFLETYLQLLPLRHNCFLFFKHKTLKSYIYKRGGTNDDDSNKAEGFLFDPNEIRWYRLSFAYIPSGFYPSGSSGGLVSWVSEEAGLKTILLCNPLVGSVSQLPPISRPRLFPSIGLSVTPTSIDVTVAGDDLISPYAVKNLSSESFHVDAGGFFSLWAMTSSLPRLCSLESGKMVYVQGKFYCMNYSPFSVLSYEVTGNRWIKIQAPMRRFLRSPSLLESKGRLILVAAVEKSKLNVPKSLRLWSLQQDNATWVEIERMPQPLYTQFAAEEGGKGFECVGNQEFVMIVLRGTSLQLLFDIVRKSWLWVPPCPYSGSGGGSSGGGSDGEVLQGFAYDPVLTTPVVSLLDQLTLPFPGVC
Sequence Length
442
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,047 Da
NCBI Official Full Name
F-box family protein
NCBI Official Symbol
UFO
NCBI Official Synonym Symbols
F17F8.16; UNUSUAL FLORAL ORGANS
NCBI Protein Information
F-box family protein
UniProt Protein Name
Protein UNUSUAL FLORAL ORGANS
UniProt Gene Name
UFO
UniProt Synonym Gene Names
FBX1; AtFBX1

NCBI Description

Required for the proper identity of the floral meristem. Involved in establishing the whorled pattern of floral organs, in the control of specification of the floral meristem, and in the activation of APETALA3 and PISTILLATA. UFO is found at the AP3 promoter in a LFY-dependent manner, suggesting that it works with LFY to regulate AP3 expression. UFO may also promote the ubiquitylation of LFY.

Uniprot Description

Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (). Considered as a meristem identity factor required for normal growth of the young floral meristem. Acts together with LEAFY to positively regulate the B class floral homeotic genes APETALA3 and PISTILLATA. In this way, operates as a region-specific regulator for petal and stamen development. Alternatively, may play a role as a negative regulator of the C class floral homeotic genes. Interacts together with the SKP1-like protein ASK1 to form a ubiquitin E3 ligase complex and could indirectly promote the ubiquitination and degradation of specific proteins controlling the floral primordia development like repressors of B class floral homeotic genes.

Research Articles on UFO

Similar Products

Product Notes

The UFO ufo (Catalog #AAA1339564) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-442, Full length protein. The amino acid sequence is listed below: MDSTVFINNP SLTLPFSYTF TSSSNSSTTT STTTDSSSGQ WMDGRIWSKL PPPLLDRVIA FLPPPAFFRT RCVCKRFYSL LFSNTFLETY LQLLPLRHNC FLFFKHKTLK SYIYKRGGTN DDDSNKAEGF LFDPNEIRWY RLSFAYIPSG FYPSGSSGGL VSWVSEEAGL KTILLCNPLV GSVSQLPPIS RPRLFPSIGL SVTPTSIDVT VAGDDLISPY AVKNLSSESF HVDAGGFFSL WAMTSSLPRL CSLESGKMVY VQGKFYCMNY SPFSVLSYEV TGNRWIKIQA PMRRFLRSPS LLESKGRLIL VAAVEKSKLN VPKSLRLWSL QQDNATWVEI ERMPQPLYTQ FAAEEGGKGF ECVGNQEFVM IVLRGTSLQL LFDIVRKSWL WVPPCPYSGS GGGSSGGGSD GEVLQGFAYD PVLTTPVVSL LDQLTLPFPG VC. It is sometimes possible for the material contained within the vial of "Protein UNUSUAL FLORAL ORGANS (UFO), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.