Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Ubiquitin carboxyl-terminal hydrolase isozyme L5 Recombinant Protein | UCHL5 recombinant protein

Recombinant Human Ubiquitin carboxyl-terminal hydrolase isozyme L5

Gene Names
UCHL5; UCH37; CGI-70; INO80R; UCH-L5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ubiquitin carboxyl-terminal hydrolase isozyme L5; Recombinant Human Ubiquitin carboxyl-terminal hydrolase isozyme L5; Ubiquitin C-terminal hydrolase UCH37; Ubiquitin thioesterase L5; UCHL5 recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-326aa; Full Length of Isoform 4
Sequence
MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKFEKHFEKTLLGK
Sequence Length
326
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for UCHL5 recombinant protein
Protease that specifically cleaves 'Lys-48'-linked polyubiquitin chains. Deubiquitinating enzyme associated with the 19S regulatory subunit of the 26S proteasome. Putative regulatory component of the INO80 complex; however is inactive in the INO80 complex and is activated by a transient interaction of the INO80 complex with the proteasome via ADRM1.
Product Categories/Family for UCHL5 recombinant protein
References
Proteasome recruitment and activation of the Uch37 deubiquitinating enzyme by Adrm1.Yao T., Song L., Xu W., De;Martino G.N., Florens L., Swanson S.K., Washburn M.P., Conaway R.C., Conaway J.W., Cohen R.E.Nat. Cell Biol. 8:994-1002(2006)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53.4 kDa
NCBI Official Full Name
ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 2
NCBI Official Synonym Full Names
ubiquitin C-terminal hydrolase L5
NCBI Official Symbol
UCHL5
NCBI Official Synonym Symbols
UCH37; CGI-70; INO80R; UCH-L5
NCBI Protein Information
ubiquitin carboxyl-terminal hydrolase isozyme L5
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase isozyme L5
UniProt Gene Name
UCHL5
UniProt Synonym Gene Names
UCH37; UCH-L5
UniProt Entry Name
UCHL5_HUMAN

Uniprot Description

UCHL5: Protease that specifically cleaves 'Lys-48'-linked polyubiquitin chains. Deubiquitinating enzyme associated with the 19S regulatory subunit of the 26S proteasome. Putative regulatory component of the INO80 complex; however is inactive in the INO80 complex and is activated by a transient interaction of the INO80 complex with the proteasome via ADRM1. Belongs to the peptidase C12 family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Protease; Ubiquitin conjugating system; EC 3.4.19.12; Ubiquitin-specific protease

Chromosomal Location of Human Ortholog: 1q32

Cellular Component: cytosol; nucleus; proteasome complex

Molecular Function: endopeptidase inhibitor activity; omega peptidase activity; protein binding; ubiquitin-specific protease activity

Biological Process: DNA recombination; DNA repair; forebrain morphogenesis; lateral ventricle development; midbrain development; negative regulation of transforming growth factor beta receptor signaling pathway; protein deubiquitination; regulation of transcription, DNA-dependent; transcription, DNA-dependent; transforming growth factor beta receptor signaling pathway; ubiquitin-dependent protein catabolic process

Research Articles on UCHL5

Similar Products

Product Notes

The UCHL5 uchl5 (Catalog #AAA969628) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-326aa; Full Length of Isoform 4. The amino acid sequence is listed below: MTGNAGEWCL MESDPGVFTE LIKGFGCRGA QVEEIWSLEP ENFEKLKPVH GLIFLFKWQP GEEPAGSVVQ DSRLDTIFFA KQVINNACAT QAIVSVLLNC THQDVHLGET LSEFKEFSQS FDAAMKGLAL SNSDVIRQVH NSFARQQMFE FDTKTSAKEE DAFHFVSYVP VNGRLYELDG LREGPIDLGA CNQDDWISAV RPVIEKRIQK YSEGEIRFNL MAIVSDRKMI YEQKIAELQR QLAEEPMDTD QGNSMLSAIQ SEVAKNQMLI EEEVQKLKRY KIENIRRKHN YLPFIMELLK TLAEHQQLIP LVEKFEKHFE KTLLGK. It is sometimes possible for the material contained within the vial of "Ubiquitin carboxyl-terminal hydrolase isozyme L5, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual