Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE (12% SDS-PAGE:)

UBE3A / Ubiquitin-Protein Ligase E3A Recombinant Protein | UBE3A recombinant protein

Ubiquitin-protein ligase E3A

Gene Names
UBE3A; AS; ANCR; E6-AP; HPVE6A; EPVE6AP
Applications
ELISA, Western Blot
Purity
>90%
Synonyms
UBE3A / Ubiquitin-Protein Ligase E3A; Ubiquitin-protein ligase E3A; E6AP ubiquitin-protein ligase; HECT-type ubiquitin transferase E3A; Human papillomavirus E6-associated protein; Oncogenic protein-associated protein E6-AP; Renal carcinoma antigen NY-REN-54; E6AP; EPVE6AP; HPVE6A; UBE3A recombinant protein
Ordering
Host
E. coli
Purity/Purification
>90%
Form/Format
50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole, 10% glycerol (PH 8.0)
Concentration
1mg/mL (varies by lot)
Sequence
MEKLHQCYWKSGEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIKMNKKGARIDFKDVTYTEEKVYEILELCREREDYSPLIRVIGRVFSSAEALVQSFRKVKQHTKEELKSLQAKDEDKDEDEKEKAACSAAAMEEDSEASSSRIGDSSQGD
Applicable Applications for UBE3A recombinant protein
ELISA (EIA), Western Blot (WB), Antigen Protein (AP)
Organism
Homo sapiens (human)
Preparation and Storage
Store at -20°C. (Avoid repeated freezing and thawing.)

SDS-PAGE

(12% SDS-PAGE:)

SDS-PAGE (12% SDS-PAGE:)
Related Product Information for UBE3A recombinant protein
Recombinant protein with His-tag

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24.31KD
NCBI Official Full Name
ubiquitin-protein ligase E3A isoform 2
NCBI Official Synonym Full Names
ubiquitin protein ligase E3A
NCBI Official Symbol
UBE3A
NCBI Official Synonym Symbols
AS; ANCR; E6-AP; HPVE6A; EPVE6AP
NCBI Protein Information
ubiquitin-protein ligase E3A
UniProt Protein Name
Ubiquitin-protein ligase E3A
Protein Family
UniProt Gene Name
UBE3A
UniProt Synonym Gene Names
E6AP; EPVE6AP; HPVE6A
UniProt Entry Name
UBE3A_HUMAN

NCBI Description

This gene encodes an E3 ubiquitin-protein ligase, part of the ubiquitin protein degradation system. This imprinted gene is maternally expressed in brain and biallelically expressed in other tissues. Maternally inherited deletion of this gene causes Angelman Syndrome, characterized by severe motor and intellectual retardation, ataxia, hypotonia, epilepsy, absence of speech, and characteristic facies. The protein also interacts with the E6 protein of human papillomavirus types 16 and 18, resulting in ubiquitination and proteolysis of tumor protein p53. Alternative splicing of this gene results in three transcript variants encoding three isoforms with different N-termini. Additional transcript variants have been described, but their full length nature has not been determined. [provided by RefSeq, Jul 2008]

Research Articles on UBE3A

Similar Products

Product Notes

The UBE3A ube3a (Catalog #AAA2903579) is a Recombinant Protein produced from E. coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's UBE3A / Ubiquitin-Protein Ligase E3A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB), Antigen Protein (AP). Researchers should empirically determine the suitability of the UBE3A ube3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEKLHQCYWK SGEPQSDDIE ASRMKRAAAK HLIERYYHQL TEGCGNEACT NEFCASCPTF LRMDNNAAAI KALELYKINA KLCDPHPSKK GASSAYLENS KGAPNNSCSE IKMNKKGARI DFKDVTYTEE KVYEILELCR EREDYSPLIR VIGRVFSSAE ALVQSFRKVK QHTKEELKSL QAKDEDKDED EKEKAACSAA AMEEDSEASS SRIGDSSQGD. It is sometimes possible for the material contained within the vial of "UBE3A / Ubiquitin-Protein Ligase E3A, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.