Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Ubiquitin-conjugating enzyme E2 K (Ube2k) Recombinant Protein | Ube2k recombinant protein

Recombinant Mouse Ubiquitin-conjugating enzyme E2 K (Ube2k)

Gene Names
Ube2k; Lig; Hip2; Hypg; HIP-2; E2-25k; AW492011; D5Ertd601e
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ubiquitin-conjugating enzyme E2 K (Ube2k); Recombinant Mouse Ubiquitin-conjugating enzyme E2 K (Ube2k); Ube2k recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-200, Full length protein
Sequence
ANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSWDVETATELLLSN
Sequence Length
199
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Ube2k recombinant protein
This protein belongs to the ubiquitin-conjugating enzyme family. This protein interacts with RING finger proteins, and it can ubiquitinate huntingtin, the gene product for Huntington s disease. Known functions for this protein include a role in aggregate formation of expanded polyglutamine proteins and the suppression of apoptosis in polyglutamine diseases, a role in the dislocation of newly synthesized MHC class I heavy chains from the endoplasmic reticulum, and involvement in foam cell formation. Multiple transcript variants encoding different isoforms have been identified for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,407 Da
NCBI Official Full Name
ubiquitin-conjugating enzyme E2 K isoform 1
NCBI Official Synonym Full Names
ubiquitin-conjugating enzyme E2K
NCBI Official Symbol
Ube2k
NCBI Official Synonym Symbols
Lig; Hip2; Hypg; HIP-2; E2-25k; AW492011; D5Ertd601e
NCBI Protein Information
ubiquitin-conjugating enzyme E2 K
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 K
UniProt Gene Name
Ube2k
UniProt Synonym Gene Names
Hip2; HIP-2; Ubiquitin-conjugating enzyme E2(25K); Ubiquitin-conjugating enzyme E2-25K

Uniprot Description

Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro, in the presence or in the absence of BRCA1-BARD1 E3 ubiquitin-protein ligase complex, catalyzes the synthesis of 'Lys-48'-linked polyubiquitin chains. Does not transfer ubiquitin directly to but elongates monoubiquitinated substrate protein. Mediates the selective degradation of short-lived and abnormal proteins, such as the endoplasmic reticulum-associated degradation (ERAD) of misfolded lumenal proteins. Ubiquitinates huntingtin. May mediate foam cell formation by the suppression of apoptosis of lipid-bearing macrophages through ubiquitination and subsequence degradation of p53/TP53. Proposed to be involved in ubiquitination and proteolytic processing of NF-kappa-B; in vitro supports ubiquitination of NFKB1. Involved in stabilization of CASP12 during ER stress-mediated amyloid-beta neurotoxicity probably by inhibiting proteasome activity; in vitro ubiquitinates CASP12.

Research Articles on Ube2k

Similar Products

Product Notes

The Ube2k ube2k (Catalog #AAA952661) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-200, Full length protein. The amino acid sequence is listed below: ANIAVQRIKR EFKEVLKSEE TSKNQIKVDL VDENFTELRG EIAGPPDTPY EGGRYQLEIK IPETYPFNPP KVRFITKIWH PNISSVTGAI CLDILKDQWA AAMTLRTVLL SLQALLAAAE PDDPQDAVVA NQYKQNPEMF KQTARLWAHV YAGAPVSSPE YTKKIENLCA MGFDRNAVIV ALSSKSWDVE TATELLLSN. It is sometimes possible for the material contained within the vial of "Ubiquitin-conjugating enzyme E2 K (Ube2k), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.