Ubiquitin-conjugating enzyme E2 D2 (UBE2D2) Recombinant Protein | UBE2D2 recombinant protein

Recombinant Human Ubiquitin-conjugating enzyme E2 D2 (UBE2D2)

Cat. Num. AAA956951

• Gene Names: UBE2D2; UBC4; PUBC1; UBCH4; UBC4/5; UBCH5B; E2(17)KB2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ubiquitin-conjugating enzyme E2 D2 (UBE2D2); Recombinant Human Ubiquitin-conjugating enzyme E2 D2 (UBE2D2); UBE2D2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-147, Full length protein
• Sequence: MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM
• Sequence Length: 147

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for UBE2D2 recombinant protein

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Two alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms.

NCBI and Uniprot Product Information

• NCBI GI #: 4507775
• NCBI GeneID: 7322
• NCBI Accession #: NP_003330.1
• NCBI GenBank Nucleotide #: NM_003339.2
• UniProt Accession #: P62837; P51669; Q3MN78; Q96RP6; D3DQC9
• Molecular Weight: 13,635 Da
• NCBI Official Full Name: ubiquitin-conjugating enzyme E2 D2 isoform 1
• NCBI Official Synonym Full Names: ubiquitin conjugating enzyme E2 D2
• NCBI Official Symbol: UBE2D2
• NCBI Official Synonym Symbols: UBC4; PUBC1; UBCH4; UBC4/5; UBCH5B; E2(17)KB2
• NCBI Protein Information: ubiquitin-conjugating enzyme E2 D2
• UniProt Protein Name: Ubiquitin-conjugating enzyme E2 D2
• Protein Family: Ubiquitin-conjugating enzyme
• UniProt Gene Name: UBE2D2
• UniProt Synonym Gene Names: PUBC1; UBC4; UBC5B; UBCH4; UBCH5B

NCBI Description

Regulated degradation of misfolded, damaged or short-lived proteins in eukaryotes occurs via the ubiquitin (Ub)-proteasome system (UPS). An integral part of the UPS system is the ubiquitination of target proteins and covalent linkage of Ub-containing proteins to form polymeric chains, marking them as targets for 26S proteasome-mediated degradation. Ubiquitination of proteins is mediated by a cascade of enzymes which includes E1 (ubiquitin activating), E2 (ubiquitin conjugating), and E3 (ubiquitin ligases) enzymes. This gene encodes a member of the E2 enzyme family. Substrates of this enzyme include the tumor suppressor protein p53 and peroxisomal biogenesis factor 5 (PEX5). Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013]

Uniprot Description

Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Mediates the selective degradation of short-lived and abnormal proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Mediates ubiquitination of PEX5 and autoubiquitination of STUB1 and TRAF6. Involved in the signal-induced conjugation and subsequent degradation of NFKBIA, FBXW2-mediated GCM1 ubiquitination and degradation, MDM2-dependent degradation of p53/TP53 and the activation of MAVS in the mitochondria by DDX58/RIG-I in response to viral infection. Essential for viral activation of IRF3.