Ubiquitin-conjugating enzyme E2 2 (UBC2) Recombinant Protein | UBC2 recombinant protein
Recombinant Ustilago maydis Ubiquitin-conjugating enzyme E2 2 (UBC2)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ubiquitin-conjugating enzyme E2 2 (UBC2); Recombinant Ustilago maydis Ubiquitin-conjugating enzyme E2 2 (UBC2); UBC2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-185, Full length protein
Sequence
MSTPSKKRLIRDFKRLSTDPPGGISGAPCADNLMIWNAVIFGPADTPFEDGTFKLVLTFDESYPNKPPTVKFLSKMFHPNVYANGELCLDILQNRWSPTYDVAAILTSIQSLLHDPNPNSPANAEAASLYRENMKEYVRRVKATVEASWLDDGEMPESIEEDDEAEAEAEAEATVDRSAPQTASA
Sequence Length
185
Species
Ustilago maydis (strain 521 / FGSC 9021) (Smut fungus)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,411 Da
NCBI Official Full Name
putative E2 ubiquitin-conjugating protein RAD6
NCBI Official Symbol
UMAG_01208
NCBI Protein Information
putative E2 ubiquitin-conjugating protein RAD6
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 2
Protein Family
UniProt Gene Name
UBC2
Uniprot Description
Catalyzes the covalent attachment of ubiquitin to other proteins. Plays a role in transcription regulation by catalyzing the monoubiquitination of histone H2B to form H2BK123ub1. H2BK123ub1 gives a specific tag for epigenetic transcriptional activation and is also a prerequisite for H3K4me and H3K79me formation. Also involved in postreplication repair of UV-damaged DNA, in N-end rule-dependent protein degradation and in sporulation.
Similar Products
Product Notes
The UBC2 ubc2 (Catalog #AAA1432109) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-185, Full length protein. The amino acid sequence is listed below: MSTPSKKRLI RDFKRLSTDP PGGISGAPCA DNLMIWNAVI FGPADTPFED GTFKLVLTFD ESYPNKPPTV KFLSKMFHPN VYANGELCLD ILQNRWSPTY DVAAILTSIQ SLLHDPNPNS PANAEAASLY RENMKEYVRR VKATVEASWL DDGEMPESIE EDDEAEAEAE AEATVDRSAP QTASA. It is sometimes possible for the material contained within the vial of "Ubiquitin-conjugating enzyme E2 2 (UBC2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
