Ubc12 Recombinant Protein
Ubc12, Recombinant, Human (Ubiquitin Conjugating Enzyme 12)
Purity
Highly Purified95% as determined by RP-HPLC, anion-exchange FPLC and/or reducing and non-reducing SDS-PAGE Silver Stained gel.
Synonyms
Ubc12; Recombinant; Human (Ubiquitin Conjugating Enzyme 12); Ubc12 recombinant protein
Host
E Coli
Purity/Purification
Highly Purified
95% as determined by RP-HPLC, anion-exchange FPLC and/or reducing and non-reducing SDS-PAGE Silver Stained gel.
95% as determined by RP-HPLC, anion-exchange FPLC and/or reducing and non-reducing SDS-PAGE Silver Stained gel.
Form/Format
Supplied as a lyophilized powder in 1X PBS, 1mM DTT, pH 7.5.
Sequence
MSYYHHHHHHDYDIPTTENLYFQGAMDPEFRIWMIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINE LNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNIL REDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK.
Endotoxin Level
0.1ng/ug (IEU/ug) of rHuUbc12.
Solubility
It is recommended to reconstitute the lyophilized rHuUbc12 in sterile water not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Preparation and Storage
-20 degree C
Stability: Lyophilized rHuUbc12 although stable at room temperature for 3 weeks, should be stored desiccated below -180C. Upon reconstitution rhUbc12 should be stored at 40C between 2-7 days and for future use below -180C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please avoid freeze-thaw cycles.
Stability: Lyophilized rHuUbc12 although stable at room temperature for 3 weeks, should be stored desiccated below -180C. Upon reconstitution rhUbc12 should be stored at 40C between 2-7 days and for future use below -180C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please avoid freeze-thaw cycles.
Related Product Information for Ubc12 recombinant protein
Recombinant Human UbcH12 is functional in in vitro NEDDylation reactions. It has been shown to form a thioester linkage with NEDD8 in the presence of the NEDD8 activating enzyme complex Uba3/APP-BP1. APP-BP1 binds to the amyloid precursor protein (APP) carboxy terminal domain and is important in conjunction with Uba3 and UbcH12 in driving cells through the S to M checkpoint. It was demonstrated to be the E2 responsible for the NEDDylation of the Cul-1 component of the SCF(-TRCP) complex which is important as the E3-ligase in the ubiquitinylation of I B. NEDDylation of Cul-1 is essential for conjugation and processing of NF- B p105 by SCF(-TRCP) following phosphorylation of the complex. A dominant negative form of UbcH12, previously demonstrated to sequester NEDD8 and inhibit its conjugation, inhibits both conjugation and processing of p105, which is alleviated by wild-type UbcH12. Recombinant Human Ubiquitin Conjugating Enzyme 12 produced in E.coli is a 25kD protein containing 216 amino acids.
Product Categories/Family for Ubc12 recombinant protein
Similar Products
Product Notes
The Ubc12 (Catalog #AAA636425) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MSYYHHHHHH DYDIPTTENL YFQGAMDPEF RIWMIKLFSL KQQKKEEESA GGTKGSSKKA SAAQLRIQKD INE LNLPKTCDIS FSDPDDLLNF KLVICPDEGF YKSGKFVFSF KVGQGYPHDP PKVKCETMVY HPNIDLEGNV CLNIL REDWKPVLTI NSIIYGLQYL FLEPNPEDPL NKEAVLQNNR RLFEQNVQRS MRGGYIGSTY FERCLK. It is sometimes possible for the material contained within the vial of "Ubc12, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
