UBC10 recombinant protein
Ubc10, Recombinant, Human (Ubiquitin Conjugating Enzyme 10)
Gene Names
UBC10; ubiquitin-conjugating enzyme 10
Purity
Highly Purified95% as determined by RP-HPLC, anion-exchange FPLC and/or reducing and non-reducing SDS-PAGE Silver Stained gel.
Synonyms
Ubc10; Recombinant; Human (Ubiquitin Conjugating Enzyme 10); UBC10 recombinant protein
Host
E Coli
Purity/Purification
Highly Purified
95% as determined by RP-HPLC, anion-exchange FPLC and/or reducing and non-reducing SDS-PAGE Silver Stained gel.
95% as determined by RP-HPLC, anion-exchange FPLC and/or reducing and non-reducing SDS-PAGE Silver Stained gel.
Form/Format
Supplied as a lyophilized powder in 1X PBS, 1mM DTT, pH 7.5.
Sequence
MHHHHHHAMGIRMASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFK WVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLL GEPNIDSPLNTHAAELWKNPTAFKKYLQESKQVTSQEP.
Endotoxin Level
0.1ng/ug (IEU/ug) of Recombinant Human Ubiquitin Conjugating Enzyme 10.
Solubility
It is recommended to reconstitute the lyophilized Human Ubc10 in sterile water not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Preparation and Storage
-20 degree C
Stability: Lyophilized Recombinant Human Ubc10 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution rhUbc10 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please avoid freeze-thaw cycles.
Stability: Lyophilized Recombinant Human Ubc10 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution rhUbc10 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please avoid freeze-thaw cycles.
Related Product Information for UBC10 recombinant protein
UbcH10 is an essential mediator of mitotic destruction events and cell cycle progression. It catalyzes the destruction of cyclins A and B in conjunction with the anaphase-promoting complex, and therefore, plays an important role in the control of the cell exit from mitosis This activity is essential at then end of mitosis for the inactivation of their partner kinase Cdc2 and exit from mitosis into G1 of the next cell cycle. In addition, UbcH10 bears homology to yeast PAS2, a gene that is essential for biogenesis of peroxisomes. UbcH10 is useful for in vitro ubiquitinylation reactions. Recombinant Human Ubiquitin Conjugating Enzyme 10 produced in E.coli is a 21.1kD protein containing 191 amino acids. Recombinant Ubc10 protein contains 6xHis tag and is purified by proprietary chromatographic techniques.
Product Categories/Family for UBC10 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
21.1kD
NCBI Official Full Name
ubiquitin-conjugating enzyme E2 10
NCBI Official Symbol
UBC10
NCBI Official Synonym Symbols
ubiquitin-conjugating enzyme 10
NCBI Protein Information
ubiquitin-conjugating enzyme E2 10
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 10
Protein Family
UniProt Gene Name
UBC10
UniProt Synonym Gene Names
UBC12
UniProt Entry Name
UBC10_ARATH
Uniprot Description
Function: Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Mediates the selective degradation of short-lived and abnormal proteins. Ref.2
Catalytic activity: ATP + ubiquitin + protein lysine = AMP + diphosphate + protein N-ubiquityllysine.
Pathway: Protein modification; protein ubiquitination.
Subunit structure: Interacts with CHIP and the E3 ubiquitin ligase BB. Ref.7 Ref.8
Tissue specificity: Ubiquitously expressed with the highest levels in rosette leaves, roots and petals. Ref.2
Sequence similarities: Belongs to the ubiquitin-conjugating enzyme family.
Sequence caution: The sequence Z14993 differs from that shown. Reason: Artifacts of PCR amplification. Originally thought to be UBC12 isoform.
Similar Products
Product Notes
The UBC10 ubc10 (Catalog #AAA637012) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MHHHHHHAMG IRMASQNRDP AATSVAAARK GAEPSGGAAR GPVGKRLQQE LMTLMMSGDK GISAFPESDN LFK WVGTIHGAAG TVYEDLRYKL SLEFPSGYPY NAPTVKFLTP CYHPNVDTQG NICLDILKEK WSALYDVRTI LLSIQSLL GEPNIDSPLN THAAELWKNP TAFKKYLQES KQVTSQEP. It is sometimes possible for the material contained within the vial of "Ubc10, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
