Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Thioredoxin, mitochondrial (TXN2) Recombinant Protein | TXN2 recombinant protein

Recombinant Human Thioredoxin, mitochondrial (TXN2)

Gene Names
TXN2; MTRX; TRX2; MT-TRX
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Thioredoxin; mitochondrial (TXN2); Recombinant Human Thioredoxin; mitochondrial; MTRX; Mt-Trx; Thioredoxin-2; TXN2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-166aa; Full Length
Sequence
TTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG
Sequence Length
107
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for TXN2 recombinant protein
Important for the control of mitochondrial reactive oxygen species homeostasis, apoptosis regulation and cell viability. Possesses a dithiol-reducing activity.
Product Categories/Family for TXN2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38.9 kDa
NCBI Official Full Name
thioredoxin, mitochondrial
NCBI Official Synonym Full Names
thioredoxin 2
NCBI Official Symbol
TXN2
NCBI Official Synonym Symbols
MTRX; TRX2; MT-TRX
NCBI Protein Information
thioredoxin, mitochondrial; thioredoxin-2; mitochondrial thioredoxin
UniProt Protein Name
Thioredoxin, mitochondrial
UniProt Gene Name
TXN2
UniProt Synonym Gene Names
TRX2; MTRX; Mt-Trx
UniProt Entry Name
THIOM_HUMAN

NCBI Description

This nuclear gene encodes a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. The encoded protein may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis. [provided by RefSeq, Jul 2008]

Uniprot Description

TXN2: Has an anti-apoptotic function and plays an important role in the regulation of mitochondrial membrane potential. Could be involved in the resistance to anti-tumor agents. Possesses a dithiol-reducing activity. Belongs to the thioredoxin family.

Protein type: Oxidoreductase

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: mitochondrion; cell soma; mitochondrial matrix; dendrite; nucleolus

Molecular Function: peptide-methionine-(S)-S-oxide reductase activity; protein complex binding; protein disulfide oxidoreductase activity; peptide-methionine (R)-S-oxide reductase activity

Biological Process: response to drug; response to reactive oxygen species; cellular response to nutrient levels; cell redox homeostasis; response to glucose stimulus; response to hormone stimulus; response to hypoxia; response to axon injury; response to organic cyclic substance; glycerol ether metabolic process; response to nutrient

Research Articles on TXN2

Similar Products

Product Notes

The TXN2 txn2 (Catalog #AAA1384705) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-166aa; Full Length. The amino acid sequence is listed below: TTFNIQDGPD FQDRVVNSET PVVVDFHAQW CGPCKILGPR LEKMVAKQHG KVVMAKVDID DHTDLAIEYE VSAVPTVLAM KNGDVVDKFV GIKDEDQLEA FLKKLIG. It is sometimes possible for the material contained within the vial of "Thioredoxin, mitochondrial (TXN2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.