Golgi apparatus membrane protein TVP38 (TVP38) Recombinant Protein | PGUG_02638 recombinant protein
Recombinant Meyerozyma guilliermondii Golgi apparatus membrane protein TVP38 (TVP38)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Golgi apparatus membrane protein TVP38 (TVP38); Recombinant Meyerozyma guilliermondii Golgi apparatus membrane protein TVP38 (TVP38); Recombinant Golgi apparatus membrane protein TVP38 (TVP38); Golgi apparatus membrane protein TVP38; PGUG_02638 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-349
Sequence
MPRLHSASEPPATGFFARVRNELGNRTEGLHQINNQALDWYRSQSQIRQILIQIGGVVAIVIGVLVLIFHKYLIELLVIISDDWAKLPGGRLILFLLVFFVGFPPLIGYSALSLLAGMVYGFPYGWPLLASASVSGSFVAFLVFRYFLRSQGERLVNSNEKFRAFAEILREDSSLFLLVLIRLCPLPYSLSNGALAAIPELSAWVYLGASVITSPKMLIHLFVGHKIKEFGDAKTDTSTKIIDVISILVTGAAASLTTFIIYRKMQQKLHHNRAGANYDAFVFGNFDDLESGTNVELNSADFDQDNFIITDDELEEEEPNGSHTATATQVQVARRNCSKAMTICTLMFV
Sequence Length
349
Species
Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) (Yeast) (Candida guilliermondii)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38,715 Da
NCBI Official Full Name
hypothetical protein PGUG_02638
NCBI Official Symbol
PGUG_02638
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Golgi apparatus membrane protein TVP38
UniProt Gene Name
TVP38
UniProt Entry Name
TVP38_PICGU
Uniprot Description
Function: Golgi membrane protein involved in vesicular trafficking and spindle migration.
Subcellular location: Golgi apparatus membrane; Multi-pass membrane protein.
Sequence similarities: Belongs to the TVP38/TMEM64 family.
Similar Products
Product Notes
The PGUG_02638 tvp38 (Catalog #AAA1107113) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-349. The amino acid sequence is listed below: MPRLHSASEP PATGFFARVR NELGNRTEGL HQINNQALDW YRSQSQIRQI LIQIGGVVAI VIGVLVLIFH KYLIELLVII SDDWAKLPGG RLILFLLVFF VGFPPLIGYS ALSLLAGMVY GFPYGWPLLA SASVSGSFVA FLVFRYFLRS QGERLVNSNE KFRAFAEILR EDSSLFLLVL IRLCPLPYSL SNGALAAIPE LSAWVYLGAS VITSPKMLIH LFVGHKIKEF GDAKTDTSTK IIDVISILVT GAAASLTTFI IYRKMQQKLH HNRAGANYDA FVFGNFDDLE SGTNVELNSA DFDQDNFIIT DDELEEEEPN GSHTATATQV QVARRNCSKA MTICTLMFV. It is sometimes possible for the material contained within the vial of "Golgi apparatus membrane protein TVP38 (TVP38), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
