Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Golgi apparatus membrane protein TVP23 (TVP23) Recombinant Protein | TVP23 recombinant protein

Recombinant Saccharomyces cerevisiae Golgi apparatus membrane protein TVP23 (TVP23)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Golgi apparatus membrane protein TVP23 (TVP23); Recombinant Saccharomyces cerevisiae Golgi apparatus membrane protein TVP23 (TVP23); Recombinant Golgi apparatus membrane protein TVP23 (TVP23); Golgi apparatus membrane protein TVP23; TLG2 compartment vesicle protein of 23 kDa; TVP23 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-199
Sequence
MDQARNFYNTILKSSHPLLLSFHLAGKAVPIVFYIIGSMFLNFTPQFITVVLLLSFDFYLTKNITGRKLVQLRWWYDSTDVNKDSNFTFESYKQYAPGPPINAIDSKLFWWSMYVTPVIWGVFAVLCLLRLKIFYLILVIVAMCLTAWNTYGFRCCDRWEPNSGQSDGQDTNNWFALPSVPGFENLSRLANIQSFFQRQ
Sequence Length
199
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,148 Da
NCBI Official Full Name
Tvp23p
NCBI Official Symbol
TVP23
NCBI Protein Information
Tvp23p
UniProt Protein Name
Golgi apparatus membrane protein TVP23
UniProt Gene Name
TVP23
UniProt Entry Name
TVP23_YEAST

Uniprot Description

Function: Golgi membrane protein involved in vesicular trafficking. Ref.6

Subunit structure: Interacts with YIP4 and YIP5. Ref.6

Subcellular location: Golgi apparatus membrane; Multi-pass membrane protein Ref.5 Ref.6.

Miscellaneous: Present with 1040 molecules/cell in log phase SD medium.

Sequence similarities: Belongs to the FAM18/TVP23 family.

Research Articles on TVP23

Similar Products

Product Notes

The TVP23 tvp23 (Catalog #AAA1103096) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-199. The amino acid sequence is listed below: MDQARNFYNT ILKSSHPLLL SFHLAGKAVP IVFYIIGSMF LNFTPQFITV VLLLSFDFYL TKNITGRKLV QLRWWYDSTD VNKDSNFTFE SYKQYAPGPP INAIDSKLFW WSMYVTPVIW GVFAVLCLLR LKIFYLILVI VAMCLTAWNT YGFRCCDRWE PNSGQSDGQD TNNWFALPSV PGFENLSRLA NIQSFFQRQ. It is sometimes possible for the material contained within the vial of "Golgi apparatus membrane protein TVP23 (TVP23), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.