Golgi apparatus membrane protein tvp18 (tvp18) Recombinant Protein | SPBC32F12.12c recombinant protein
Recombinant Schizosaccharomyces pombe Golgi apparatus membrane protein tvp18 (tvp18)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Golgi apparatus membrane protein tvp18 (tvp18); Recombinant Schizosaccharomyces pombe Golgi apparatus membrane protein tvp18 (tvp18); Recombinant Golgi apparatus membrane protein tvp18 (tvp18); Golgi apparatus membrane protein tvp18; SPBC32F12.12c recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-164
Sequence
MFESIIVDRAKTTFLGELKSYNFSIYAQWLGILSIFLCIILGIVNLFHVTLVVLFSALTIIEGVLLIFIELPFLSRICPVSDKFQAFTNAFASNYYRGLVYFIFSVVTFLSCIFMATSLIATGIVLALTGLCYTFAGIKGQAFTSSSTLGGTGITTETPPSTMV
Sequence Length
164
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,922 Da
NCBI Official Full Name
golgi membrane protein involved in vesicle-mediated transport
NCBI Official Symbol
SPBC32F12.12c
NCBI Protein Information
golgi membrane protein involved in vesicle-mediated transport
UniProt Protein Name
Golgi apparatus membrane protein tvp18
UniProt Gene Name
tvp18
UniProt Entry Name
TVP18_SCHPO
Uniprot Description
Function: Golgi membrane protein involved in vesicular trafficking
By similarity.
Subcellular location: Golgi apparatus membrane; Multi-pass membrane protein Ref.2.
Sequence similarities: Belongs to the TVP18 family.
Similar Products
Product Notes
The SPBC32F12.12c tvp18 (Catalog #AAA1261360) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-164. The amino acid sequence is listed below: MFESIIVDRA KTTFLGELKS YNFSIYAQWL GILSIFLCII LGIVNLFHVT LVVLFSALTI IEGVLLIFIE LPFLSRICPV SDKFQAFTNA FASNYYRGLV YFIFSVVTFL SCIFMATSLI ATGIVLALTG LCYTFAGIKG QAFTSSSTLG GTGITTETPP STMV. It is sometimes possible for the material contained within the vial of "Golgi apparatus membrane protein tvp18 (tvp18), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
