Protein tweety homolog 3 (ttyh3) Recombinant Protein | ttyh3 recombinant protein
Recombinant Danio rerio Protein tweety homolog 3 (ttyh3)
Gene Names
ttyh3b; ttyh3; wu:fj56f11; zgc:123242
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein tweety homolog 3 (ttyh3); Recombinant Danio rerio Protein tweety homolog 3 (ttyh3); ttyh3 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-560aa; full length protein
Sequence
MAAVVNYSPPWWVNLFHRLPHFNLQFQQTSSDFRPDDSDYQKAVLLLGAAALVCLALDLL FLLFYSFWLCCCRRKNHDSPNADCCCTAWCVIIATLVCSAGIAVGFYGNGETCDGVTRLT YSLRHANQTVAGIDKLVSESTSSLNETLMEGLVQLETVYSKQTDYLSIVQKLQGQLDELI NLMLGVPFWSSNDLSLDHLASITEQYDWYRWLGYLGLLLFDVIICLLVLVGLIRNSRSIL IGVCFLGVLTLVISWASLGLEFSFAVGASDFCVSPDSYITKVTRENAVINQDILQYYLKC SMGQTNPFQQKLSGSHKALVEMQDDVSELLRSAIRDFPKTKSNLEEMQGVLNSTEVSLHH LTALVDCRSLHMDYVQALTGLCYDGVEGLIYLVLFSFVTALMFSSIVCSVPHTWQSKRSE EEDGDETSATLGSRAPHDNLYRVHMPSLYSCGSSTYGNEASLPAAAHTVSNAPVTEYMSQ NANFQTPRCENTPLIGRESPPPSYTSSMRAKYLATSRPDQPRPTESQNGLEPNMRPDLTS RSAPNSRPNSAIHRPHSAIH
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for ttyh3 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62,192 Da
NCBI Official Full Name
protein tweety homolog 3
NCBI Official Synonym Full Names
tweety family member 3b
NCBI Official Symbol
ttyh3b
NCBI Official Synonym Symbols
ttyh3; wu:fj56f11; zgc:123242
NCBI Protein Information
protein tweety homolog 3
UniProt Protein Name
Protein tweety homolog 3
Protein Family
UniProt Gene Name
ttyh3
UniProt Entry Name
TTYH3_DANRE
Uniprot Description
Probable large-conductance Ca2+-activated chloride channel.
Similar Products
Product Notes
The ttyh3 ttyh3 (Catalog #AAA7032352) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-560aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the ttyh3 ttyh3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAAVVNYSPP WWVNLFHRLP HFNLQFQQTS SDFRPDDSDY QKAVLLLGAA ALVCLALDLL FLLFYSFWLC CCRRKNHDSP NADCCCTAWC VIIATLVCSA GIAVGFYGNG ETCDGVTRLT YSLRHANQTV AGIDKLVSES TSSLNETLME GLVQLETVYS KQTDYLSIVQ KLQGQLDELI NLMLGVPFWS SNDLSLDHLA SITEQYDWYR WLGYLGLLLF DVIICLLVLV GLIRNSRSIL IGVCFLGVLT LVISWASLGL EFSFAVGASD FCVSPDSYIT KVTRENAVIN QDILQYYLKC SMGQTNPFQQ KLSGSHKALV EMQDDVSELL RSAIRDFPKT KSNLEEMQGV LNSTEVSLHH LTALVDCRSL HMDYVQALTG LCYDGVEGLI YLVLFSFVTA LMFSSIVCSV PHTWQSKRSE EEDGDETSAT LGSRAPHDNL YRVHMPSLYS CGSSTYGNEA SLPAAAHTVS NAPVTEYMSQ NANFQTPRCE NTPLIGRESP PPSYTSSMRA KYLATSRPDQ PRPTESQNGL EPNMRPDLTS RSAPNSRPNS AIHRPHSAIH. It is sometimes possible for the material contained within the vial of "Protein tweety homolog 3 (ttyh3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
