Tetraspanin-7 Recombinant Protein | TSPAN7 recombinant protein

Recombinant Human Tetraspanin-7

Cat. Num. AAA962365

• Gene Names: TSPAN7; A15; MXS1; CD231; MRX58; CCG-B7; TM4SF2; TALLA-1; TM4SF2b; DXS1692E
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Tetraspanin-7; Recombinant Human Tetraspanin-7; Cell surface glycoprotein A15; Membrane component chromosome X surface marker 1; T-cell acute lymphoblastic leukemia-associated antigen 1; TALLA-1; Transmembrane 4 superfamily member 2; CD231; TSPAN7 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 113-213aa; Extracellular Domain
• Sequence: RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM
• Sequence Length: 249

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for TSPAN7 recombinant protein

May be involved in cell proliferation and cell motility.

Product Categories/Family for TSPAN7 recombinant protein

Immunology

References

Isolation of a novel cDNA clone showing marked similarity to ME491/CD63 superfamily.Emi N., Kitaori K., Seto M., Ueda R., Saito H., Takahashi T.Immunogenetics 37:193-198(1993) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004)

NCBI and Uniprot Product Information

• NCBI GI #: 21265104
• NCBI GeneID: 7102
• NCBI Accession #: NP_004606.2
• NCBI GenBank Nucleotide #: NM_004615.3
• UniProt Accession #: P41732; Q8WVG5; Q9UEY9; B2R5W7; D3DWB1
• Molecular Weight: 14.5 kDa
• NCBI Official Full Name: tetraspanin-7
• NCBI Official Synonym Full Names: tetraspanin 7
• NCBI Official Symbol: TSPAN7
• NCBI Official Synonym Symbols: A15; MXS1; CD231; MRX58; CCG-B7; TM4SF2; TALLA-1; TM4SF2b; DXS1692E
• NCBI Protein Information: tetraspanin-7
• UniProt Protein Name: Tetraspanin-7
• Protein Family: Tetraspanin
• UniProt Gene Name: TSPAN7
• UniProt Synonym Gene Names: A15; DXS1692E; MXS1; TM4SF2; Tspan-7; TALLA-1
• UniProt Entry Name: TSN7_HUMAN

NCBI Description

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and may have a role in the control of neurite outgrowth. It is known to complex with integrins. This gene is associated with X-linked mental retardation and neuropsychiatric diseases such as Huntington's chorea, fragile X syndrome and myotonic dystrophy. [provided by RefSeq, Jul 2008]

Uniprot Description

TSPAN7: a multi-pass membrane protein. Member of the transmembrane 4 superfamily, also known as the tetraspanin family. These proteins apparently mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. Defects in TSPAN7 are the cause of mental retardation X- linked type 58 (MRX58). Mental retardation is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Non-syndromic mental retardation patients do not manifest other clinical signs.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: Xp11.4

Cellular Component: integral to plasma membrane

Biological Process: cell surface receptor linked signal transduction; viral reproduction

Disease: Mental Retardation, X-linked 58