Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Tetraspanin-15 (Tspan15) Recombinant Protein | Tspan15 recombinant protein

Recombinant Mouse Tetraspanin-15 (Tspan15)

Gene Names
Tspan15; Tm4sf15; AW048364; 1110036D12Rik; 2700063A19Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tetraspanin-15 (Tspan15); Recombinant Mouse Tetraspanin-15 (Tspan15); Recombinant Tetraspanin-15 (Tspan15); Tetraspanin-15; Tspan-15; Transmembrane 4 superfamily member 15; Tspan15 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-294
Sequence
MPRGDSEQVRYCARFSYLWLKFSLIIYSTVFWLIGGLVLSVGIYAEAERQKYKTLESAFLAPAIILILLGVVMFIVSFIGVLASLRDNLCLLQSFMYILGICLVMELIGGIVALIFRNQTIDFLNDNIRRGIENYYDDLDFKNIMDFVQKKFKCCGGEDYRDWSKNQYHDCSAPGPLACGVPYTCCIRNTTDVVNTMCGYKTIDKERLNAQNIIHVRGCTNAVLIWFMDNYTIMAGLLLGILLPQFLGVLLTLLYITRVEDIILEHSVTDGLLGPGAKSRTDTAGTGCCLCYPD
Sequence Length
294
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,071 Da
NCBI Official Full Name
tetraspanin-15
NCBI Official Synonym Full Names
tetraspanin 15
NCBI Official Symbol
Tspan15
NCBI Official Synonym Symbols
Tm4sf15; AW048364; 1110036D12Rik; 2700063A19Rik
NCBI Protein Information
tetraspanin-15; tspan-15; transmembrane 4 superfamily member 15
UniProt Protein Name
Tetraspanin-15
UniProt Gene Name
Tspan15
UniProt Synonym Gene Names
Tspan-15
UniProt Entry Name
TSN15_MOUSE

Uniprot Description

TSPAN15: is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq, Jul 2008]

Protein type: Cell surface; Membrane protein, integral; Membrane protein, multi-pass

Cellular Component: cell surface; membrane; integral to membrane; plasma membrane

Molecular Function: enzyme binding

Biological Process: protein maturation

Similar Products

Product Notes

The Tspan15 tspan15 (Catalog #AAA1065610) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-294. The amino acid sequence is listed below: MPRGDSEQVR YCARFSYLWL KFSLIIYSTV FWLIGGLVLS VGIYAEAERQ KYKTLESAFL APAIILILLG VVMFIVSFIG VLASLRDNLC LLQSFMYILG ICLVMELIGG IVALIFRNQT IDFLNDNIRR GIENYYDDLD FKNIMDFVQK KFKCCGGEDY RDWSKNQYHD CSAPGPLACG VPYTCCIRNT TDVVNTMCGY KTIDKERLNA QNIIHVRGCT NAVLIWFMDN YTIMAGLLLG ILLPQFLGVL LTLLYITRVE DIILEHSVTD GLLGPGAKSR TDTAGTGCCL CYPD. It is sometimes possible for the material contained within the vial of "Tetraspanin-15 (Tspan15), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.