Thymic stromal lymphopoietin Recombinant Protein | TSLP recombinant protein

Recombinant Human Thymic stromal lymphopoietin

Cat. Num. AAA1393144

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Thymic stromal lymphopoietin; Recombinant Human Thymic stromal lymphopoietin; Homo sapiens (Human); TSLP recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 29-159. Full Length of Mature Protein
• Sequence: YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

• Species: Homo sapiens (Human)
• Production Note: Special Offer: The Mammalian-Cell host-expressed protein is manufactured from a stock plasmid containing the protein gene. Mammalian-Cellhost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Mammalian-Cell host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Mammalian-Cell host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Related Product Information for TSLP recombinant protein

Cytokine that induces the release of T-cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c+ dendritic cells. Can induce allergic inflammation by directly activating mast cells.

Product Categories/Family for TSLP recombinant protein

Immunology

References

"Human thymic stromal lymphopoietin preferentially stimulates myeloid cells." Reche P.A., Soumelis V., Gorman D.M., Clifford T., Liu M.-R., Travis M., Zurawski S.M., Johnston J., Liu Y.-J., Spits H., de Waal Malefyt R., Kastelein R.A., Bazan J.F. J. Immunol. 167:336-343(2001)

NCBI and Uniprot Product Information

• NCBI GI #: 14719428
• NCBI GeneID: 85480
• NCBI Accession #: NP_149024.1
• NCBI GenBank Nucleotide #: NM_033035.4
• UniProt Accession #: Q969D9; Q8IW99; Q96AU7; G3XAM8
• Molecular Weight: 18.9 kDa
• NCBI Official Full Name: thymic stromal lymphopoietin isoform 1
• NCBI Official Synonym Full Names: thymic stromal lymphopoietin
• NCBI Official Symbol: TSLP
• NCBI Protein Information: thymic stromal lymphopoietin
• UniProt Protein Name: Thymic stromal lymphopoietin
• Protein Family: Thymic stromal lymphopoietin
• UniProt Gene Name: TSLP
• UniProt Entry Name: TSLP_HUMAN

NCBI Description

This gene encodes a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. It mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c(+) dendritic cells. The protein promotes T helper type 2 (TH2) cell responses that are associated with immunity in various inflammatory diseases, including asthma, allergic inflammation and chronic obstructive pulmonary disease. The protein is therefore considered a potential therapeutic target for the treatment of such diseases. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2012]

Uniprot Description

TSLP: Cytokine that induces the release of T-cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c(+) dendritic cells. Can induce allergic inflammation by directly activating mast cells.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 5q22.1

Cellular Component: extracellular space

Molecular Function: cytokine activity