Methyl-accepting chemotaxis serine transducer (tse) Recombinant Protein | EAE_15535 recombinant protein
Recombinant Enterobacter aerogenes Methyl-accepting chemotaxis serine transducer (tse)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Methyl-accepting chemotaxis serine transducer (tse); Recombinant Enterobacter aerogenes Methyl-accepting chemotaxis serine transducer (tse); Recombinant Methyl-accepting chemotaxis serine transducer (tse); Methyl-accepting chemotaxis serine transducer; EAE_15535 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-556
Sequence
MFNRIKVVTSLLLVLVLFGALQLISGGLFFSSLKSDKENFTVLQTIRQQQLLLSESRVDLLQARNSLNRAGIRYMMDTNKIGSGATIDELLAKAKEELARAERNYTAYEKIPQDPRQDPQATEKLKQQYGILYGALSELIQLLGEGKINAFFDQPTQKYQDDFEQTYNAYLQQNGKLYQIAVDASNSSYSSAIWTLIVVIIVVLAAIVGVWMGIHHILVRPLNRMIEHIKRIASGDLTQPIPVTSRNEIGVLAASLKHMQNELIETVSGVRQGADAIYSGASEIAAGNNDLSSRTEQQAASLEETAASMEQLTATVKQNAENARQASQLALSASETAQKGGKVVANVVETMHDIASSSQKIADITGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAKEIKALIEDSVNRVDMGSVLVESAGDTMGDIVNAVTRVTDIMGEIASASDEQSRGIDQVGQAVAEMDRVTQQNASLVEESASAAAALEEQASLLTQSVAVFRLKSEGQEEYKAPVSNKTAPAAIATHKKTSASDYQDNWETF
Sequence Length
556
Species
Enterobacter aerogenes (strain ATCC 13048 / DSM 30053 / JCM 1235 / KCTC 2190 / NBRC 13534 / NCIMB 10102 / NCTC 10006) (Aerobacter aerogenes)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
60,038 Da
NCBI Official Full Name
methyl-accepting chemotaxis sensory transducer
NCBI Official Symbol
EAE_15535
NCBI Protein Information
methyl-accepting chemotaxis sensory transducer
UniProt Protein Name
Methyl-accepting chemotaxis serine transducer
UniProt Gene Name
tse
UniProt Entry Name
MCPS_ENTAK
Uniprot Description
Function: Receptor for the attractant L-serine and related amino acids.Chemotactic-signal transducers respond to changes in the concentration of attractants and repellents in the environment, transduce a signal from the outside to the inside of the cell, and facilitate sensory adaptation through the variation of the level of methylation. Attractants increase the level of methylation while repellents decrease the level of methylation, the methyl groups are added by the methyltransferase CheR and removed by the methylesterase CheB.
Subcellular location: Cell inner membrane; Multi-pass membrane protein.
Sequence similarities: Contains 1 HAMP domain.Contains 1 methyl-accepting transducer domain.
Similar Products
Product Notes
The EAE_15535 tse (Catalog #AAA1089186) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-556. The amino acid sequence is listed below: MFNRIKVVTS LLLVLVLFGA LQLISGGLFF SSLKSDKENF TVLQTIRQQQ LLLSESRVDL LQARNSLNRA GIRYMMDTNK IGSGATIDEL LAKAKEELAR AERNYTAYEK IPQDPRQDPQ ATEKLKQQYG ILYGALSELI QLLGEGKINA FFDQPTQKYQ DDFEQTYNAY LQQNGKLYQI AVDASNSSYS SAIWTLIVVI IVVLAAIVGV WMGIHHILVR PLNRMIEHIK RIASGDLTQP IPVTSRNEIG VLAASLKHMQ NELIETVSGV RQGADAIYSG ASEIAAGNND LSSRTEQQAA SLEETAASME QLTATVKQNA ENARQASQLA LSASETAQKG GKVVANVVET MHDIASSSQK IADITGVIDG IAFQTNILAL NAAVEAARAG EQGRGFAVVA GEVRNLAQRS AQAAKEIKAL IEDSVNRVDM GSVLVESAGD TMGDIVNAVT RVTDIMGEIA SASDEQSRGI DQVGQAVAEM DRVTQQNASL VEESASAAAA LEEQASLLTQ SVAVFRLKSE GQEEYKAPVS NKTAPAAIAT HKKTSASDYQ DNWETF. It is sometimes possible for the material contained within the vial of "Methyl-accepting chemotaxis serine transducer (tse), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
