UPF0079 ATP-binding protein ydiB (ydiB) Recombinant Protein | ydiB recombinant protein
Recombinant Bacillus subtilis UPF0079 ATP-binding protein ydiB (ydiB)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
UPF0079 ATP-binding protein ydiB (ydiB); Recombinant Bacillus subtilis UPF0079 ATP-binding protein ydiB (ydiB); ydiB recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-158, Full length protein
Sequence
MKQLKWRTVNPEETKAIAKLTAAFAKPGDVLTLEGDLGAGKTTFTKGFAEGLGITRIVNSPTFTIIKEYNDGVLPLYHMDVYRMEDESEDLGLDEYFHGQGVCLVEWAHLIEEQLPQERLQIVIKRAGDDEREITFTAVGNRYEMLCEELSRHDNISN
Sequence Length
158
Species
Bacillus subtilis (strain 168)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,906 Da
NCBI Official Full Name
ATP-binding protein YdiB
NCBI Official Symbol
ydiB
NCBI Protein Information
ATP-binding protein YdiB
UniProt Protein Name
tRNA threonylcarbamoyladenosine biosynthesis protein TsaE
UniProt Gene Name
tsaE
UniProt Synonym Gene Names
ydiB
Uniprot Description
Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t6A37) in tRNAs that read codons beginning with adenine. Is involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37, together with TsaD and TsaB; this reaction does not require ATP in vitro. TsaE seems to play an indirect role in the t6A biosynthesis pathway, possibly in regulating the core enzymatic function of TsaD. Displays ATPase activity in vitro, which is modulated by the oligomeric status of the protein.
Research Articles on ydiB
Similar Products
Product Notes
The ydiB tsae (Catalog #AAA1157045) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-158, Full length protein. The amino acid sequence is listed below: MKQLKWRTVN PEETKAIAKL TAAFAKPGDV LTLEGDLGAG KTTFTKGFAE GLGITRIVNS PTFTIIKEYN DGVLPLYHMD VYRMEDESED LGLDEYFHGQ GVCLVEWAHL IEEQLPQERL QIVIKRAGDD EREITFTAVG NRYEMLCEEL SRHDNISN. It is sometimes possible for the material contained within the vial of "UPF0079 ATP-binding protein ydiB (ydiB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
