Transient receptor potential cation channel subfamily V member 5 (Trpv5) Recombinant Protein | Trpv5 recombinant protein
Recombinant Rabbit Transient receptor potential cation channel subfamily V member 5 (Trpv5)
Gene Names
TRPV5; ECAC
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transient receptor potential cation channel subfamily V member 5 (Trpv5); Recombinant Rabbit Transient receptor potential cation channel subfamily V member 5 (Trpv5); Trpv5 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-730aa; full length protein
Sequence
MGACPPKAKGPWAQLQKLLISWPVGEQDWEQYRDRVNMLQQERIRDSPLLQAAKENDLRL LKILLLNQSCDFQQRGAVGETALHVAALYDNLEAATLLMEAAPELAKEPALCEPFVGQTA LHIAVMNQNLNLVRALLARGASVSARATGAAFRRSPHNLIYYGEHPLSFAACVGSEEIVR LLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDEHSDHLQSLELVPNHQG LTPFKLAGVEGNTVMFQHLMQKRKHVQWTCGPLTSTLYDLTEIDSWGEELSFLELVVSSK KREARQILEQTPVKELVSFKWKKYGRPYFCVLASLYILYMICFTTCCIYRPLKLRDDNRT DPRDITILQQKLLQEAYVTHQDNIRLVGELVTVTGAVIILLLEIPDIFRVGASRYFGQTI LGGPFHVIIITYASLVLLTMVMRLTNMNGEVVPLSFALVLGWCSVMYFARGFQMLGPFTI MIQKMIFGDLMRFCWLMAVVILGFASAFHITFQTEDPNNLGEFSDYPTALFSTFELFLTI IDGPANYSVDLPFMYCITYAAFAIIATLLMLNLFIAMMGDTHWRVAQERDELWRAQVVAT TVMLERKMPRFLWPRSGICGYEYGLGDRWFLRVENHHDQNPLRVLRYVEAFKCSDKEDGQ EQLSEKRPSTVESGMLSRASVAFQTPSLSRTTSQSSNSHRGWEILRRNTLGHLNLGLDLG EGDGEEVYHF
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rabbit
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Trpv5 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82,814 Da
NCBI Official Full Name
transient receptor potential cation channel subfamily V member 5
NCBI Official Symbol
TRPV5
NCBI Official Synonym Symbols
ECAC
NCBI Protein Information
transient receptor potential cation channel subfamily V member 5
UniProt Protein Name
Transient receptor potential cation channel subfamily V member 5
Protein Family
UniProt Gene Name
Trpv5
UniProt Synonym Gene Names
Ecac1; TrpV5; ECaC1; OTRPC3
UniProt Entry Name
TRPV5_RABIT
Uniprot Description
TRPV5: Constitutively active calcium selective cation channel thought to be involved in Ca(2+) reabsorption in kidney and intestine. The channel is activated by low internal calcium level and the current exhibits an inward rectification. A Ca(2+)- dependent feedback regulation includes fast channel inactivation and slow current decay. Heteromeric assembly with TRPV6 seems to modify channel properties. TRPV5-TRPV6 heteromultimeric concatemers exhibit voltage-dependent gating. Belongs to the transient receptor (TC 1.A.4) family. TrpV subfamily. TRPV5 sub-subfamily.
Protein type: Membrane protein, integral; Membrane protein, multi-pass; Channel, cation; Motility/polarity/chemotaxis
Research Articles on Trpv5
Similar Products
Product Notes
The Trpv5 trpv5 (Catalog #AAA7032210) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-730aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Trpv5 trpv5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGACPPKAKG PWAQLQKLLI SWPVGEQDWE QYRDRVNMLQ QERIRDSPLL QAAKENDLRL LKILLLNQSC DFQQRGAVGE TALHVAALYD NLEAATLLME AAPELAKEPA LCEPFVGQTA LHIAVMNQNL NLVRALLARG ASVSARATGA AFRRSPHNLI YYGEHPLSFA ACVGSEEIVR LLIEHGADIR AQDSLGNTVL HILILQPNKT FACQMYNLLL SYDEHSDHLQ SLELVPNHQG LTPFKLAGVE GNTVMFQHLM QKRKHVQWTC GPLTSTLYDL TEIDSWGEEL SFLELVVSSK KREARQILEQ TPVKELVSFK WKKYGRPYFC VLASLYILYM ICFTTCCIYR PLKLRDDNRT DPRDITILQQ KLLQEAYVTH QDNIRLVGEL VTVTGAVIIL LLEIPDIFRV GASRYFGQTI LGGPFHVIII TYASLVLLTM VMRLTNMNGE VVPLSFALVL GWCSVMYFAR GFQMLGPFTI MIQKMIFGDL MRFCWLMAVV ILGFASAFHI TFQTEDPNNL GEFSDYPTAL FSTFELFLTI IDGPANYSVD LPFMYCITYA AFAIIATLLM LNLFIAMMGD THWRVAQERD ELWRAQVVAT TVMLERKMPR FLWPRSGICG YEYGLGDRWF LRVENHHDQN PLRVLRYVEA FKCSDKEDGQ EQLSEKRPST VESGMLSRAS VAFQTPSLSR TTSQSSNSHR GWEILRRNTL GHLNLGLDLG EGDGEEVYHF. It is sometimes possible for the material contained within the vial of "Transient receptor potential cation channel subfamily V member 5 (Trpv5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
