Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Transient receptor potential cation channel subfamily V member 3 (Trpv3) Recombinant Protein | Trpv3 recombinant protein

Recombinant Mouse Transient receptor potential cation channel subfamily V member 3 (Trpv3)

Gene Names
Trpv3; Nh; VRL3; AI644701; 1110036I10Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transient receptor potential cation channel subfamily V member 3 (Trpv3); Recombinant Mouse Transient receptor potential cation channel subfamily V member 3 (Trpv3); Trpv3 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-791aa; full length protein
Sequence
MNAHSKEMAPLMGKRTTAPGGNPVVLTEKRPADLTPTKKSAHFFLEIEGFEPNPTVTKTS PPIFSKPMDSNIRQCLSGNCDDMDSPQSPQDDVTETPSNPNSPSANLAKEEQRQKKKRLK KRIFAAVSEGCVEELRELLQDLQDLCRRRRGLDVPDFLMHKLTASDTGKTCLMKALLNIN PNTKEIVRILLAFAEENDILDRFINAEYTEEAYEGQTALNIAIERRQGDITAVLIAAGAD VNAHAKGVFFNPKYQHEGFYFGETPLALAACTNQPEIVQLLMENEQTDITSQDSRGNNIL HALVTVAEDFKTQNDFVKRMYDMILLRSGNWELETMRNNDGLTPLQLAAKMGKAEILKYI LSREIKEKPLRSLSRKFTDWAYGPVSSSLYDLTNVDTTTDNSVLEIIVYNTNIDNRHEML TLEPLHTLLHTKWKKFAKYMFFLSFCFYFFYNITLTLVSYYRPREDEDLPHPLALTHKMS WLQLLGRMFVLIWATCISVKEGIAIFLLRPSDLQSILSDAWFHFVFFVQAVLVILSVFLY LFAYKEYLACLVLAMALGWANMLYYTRGFQSMGMYSVMIQKVILHDVLKFLFVYILFLLG FGVALASLIEKCSKDKKDCSSYGSFSDAVLELFKLTIGLGDLNIQQNSTYPILFLFLLIT YVILTFVLLLNMLIALMGETVENVSKESERIWRLQRARTILEFEKMLPEWLRSRFRMGEL CKVADEDFRLCLRINEVKWTEWKTHVSFLNEDPGPIRRTADLNKIQDSSRSNSKTTLYAF DELDEFPETSV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Trpv3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
90,663 Da
NCBI Official Full Name
transient receptor potential cation channel subfamily V member 3
NCBI Official Synonym Full Names
transient receptor potential cation channel, subfamily V, member 3
NCBI Official Symbol
Trpv3
NCBI Official Synonym Symbols
Nh; VRL3; AI644701; 1110036I10Rik
NCBI Protein Information
transient receptor potential cation channel subfamily V member 3
UniProt Protein Name
Transient receptor potential cation channel subfamily V member 3
UniProt Gene Name
Trpv3
UniProt Synonym Gene Names
TrpV3
UniProt Entry Name
TRPV3_MOUSE

Uniprot Description

TRPV3: Putative receptor-activated non-selective calcium permeant cation channel. It is activated by innocuous (warm) temperatures and shows an increased response at noxious temperatures greater than 39 degrees Celsius. Activation exhibits an outward rectification. May associate with TRPV1 and may modulate its activity. Is a negative regulator of hair growth and cycling: TRPV3-coupled signaling suppresses keratinocyte proliferation in hair follicles and induces apoptosis and premature hair follicle regression (catagen). May form a heteromeric channel with TRPV1. Interacts with TRPV1. Abundantly expressed in CNS. Widely expressed at low levels. Detected in dorsal root ganglion. Expressed in the keratinocyte layers of the outer root sheath and, to lesser extent, to the matrix of the hair follicles. Belongs to the transient receptor (TC 1.A.4) family. TrpV subfamily. TRPV3 sub-subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Channel, cation

Cellular Component: integral to membrane; membrane; receptor complex

Molecular Function: calcium channel activity; cation channel activity; ion channel activity; protein binding

Biological Process: calcium ion transport; ion transport; negative regulation of hair cycle; response to temperature stimulus; transmembrane transport; transport

Research Articles on Trpv3

Similar Products

Product Notes

The Trpv3 trpv3 (Catalog #AAA7032208) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-791aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Trpv3 trpv3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNAHSKEMAP LMGKRTTAPG GNPVVLTEKR PADLTPTKKS AHFFLEIEGF EPNPTVTKTS PPIFSKPMDS NIRQCLSGNC DDMDSPQSPQ DDVTETPSNP NSPSANLAKE EQRQKKKRLK KRIFAAVSEG CVEELRELLQ DLQDLCRRRR GLDVPDFLMH KLTASDTGKT CLMKALLNIN PNTKEIVRIL LAFAEENDIL DRFINAEYTE EAYEGQTALN IAIERRQGDI TAVLIAAGAD VNAHAKGVFF NPKYQHEGFY FGETPLALAA CTNQPEIVQL LMENEQTDIT SQDSRGNNIL HALVTVAEDF KTQNDFVKRM YDMILLRSGN WELETMRNND GLTPLQLAAK MGKAEILKYI LSREIKEKPL RSLSRKFTDW AYGPVSSSLY DLTNVDTTTD NSVLEIIVYN TNIDNRHEML TLEPLHTLLH TKWKKFAKYM FFLSFCFYFF YNITLTLVSY YRPREDEDLP HPLALTHKMS WLQLLGRMFV LIWATCISVK EGIAIFLLRP SDLQSILSDA WFHFVFFVQA VLVILSVFLY LFAYKEYLAC LVLAMALGWA NMLYYTRGFQ SMGMYSVMIQ KVILHDVLKF LFVYILFLLG FGVALASLIE KCSKDKKDCS SYGSFSDAVL ELFKLTIGLG DLNIQQNSTY PILFLFLLIT YVILTFVLLL NMLIALMGET VENVSKESER IWRLQRARTI LEFEKMLPEW LRSRFRMGEL CKVADEDFRL CLRINEVKWT EWKTHVSFLN EDPGPIRRTA DLNKIQDSSR SNSKTTLYAF DELDEFPETS V. It is sometimes possible for the material contained within the vial of "Transient receptor potential cation channel subfamily V member 3 (Trpv3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.