E3 ubiquitin-protein ligase TRIM31 (TRIM31) Recombinant Protein | TRIM31 recombinant protein
Recombinant Human E3 ubiquitin-protein ligase TRIM31 (TRIM31)
Gene Names
TRIM31; RNF; HCG1; HCGI; C6orf13
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase TRIM31 (TRIM31); Recombinant Human E3 ubiquitin-protein ligase TRIM31 (TRIM31); TRIM31 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-425, Full length protein
Sequence
MASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSVRKNAIRFNSLLRNLVEKIQALQASEVQSKRKEATCPRHQEMFHYFCEDDGKFLCFVCRESKDHKSHNVSLIEEAAQNYQGQIQEQIQVLQQKEKETVQVKAQGVHRVDVFTDQVEHEKQRILTEFELLHQVLEEEKNFLLSRIYWLGHEGTEAGKHYVASTEPQLNDLKKLVDSLKTKQNMPPRQLLEDIKVVLCRSEEFQFLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQADRKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPGSSSAGGRTTSGPPNHHSSAPSHSLFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEELHAALSEWLTAIRAWFCEVPSS
Sequence Length
425
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for TRIM31 recombinant protein
This protein is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to both the cytoplasm and the nucleus. Its function has not been identified.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,831 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase TRIM31
NCBI Official Synonym Full Names
tripartite motif containing 31
NCBI Official Symbol
TRIM31
NCBI Official Synonym Symbols
RNF; HCG1; HCGI; C6orf13
NCBI Protein Information
E3 ubiquitin-protein ligase TRIM31
UniProt Protein Name
E3 ubiquitin-protein ligase TRIM31
Protein Family
UniProt Gene Name
TRIM31
UniProt Synonym Gene Names
C6orf13; RNF
NCBI Description
This gene encodes a protein that functions as an E3 ubiquitin-protein ligase. This gene shows altered expression in certain tumors and may be a negative regulator of cell growth. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
Uniprot Description
Regulator of Src-induced anchorage independent cell growth (). May have E3 ubiquitin-protein ligase activity.
Research Articles on TRIM31
Similar Products
Product Notes
The TRIM31 trim31 (Catalog #AAA1465519) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-425, Full length protein. The amino acid sequence is listed below: MASGQFVNKL QEEVICPICL DILQKPVTID CGHNFCLKCI TQIGETSCGF FKCPLCKTSV RKNAIRFNSL LRNLVEKIQA LQASEVQSKR KEATCPRHQE MFHYFCEDDG KFLCFVCRES KDHKSHNVSL IEEAAQNYQG QIQEQIQVLQ QKEKETVQVK AQGVHRVDVF TDQVEHEKQR ILTEFELLHQ VLEEEKNFLL SRIYWLGHEG TEAGKHYVAS TEPQLNDLKK LVDSLKTKQN MPPRQLLEDI KVVLCRSEEF QFLNPTPVPL ELEKKLSEAK SRHDSITGSL KKFKDQLQAD RKKDENRFFK SMNKNDMKSW GLLQKNNHKM NKTSEPGSSS AGGRTTSGPP NHHSSAPSHS LFRASSAGKV TFPVCLLASY DEISGQGASS QDTKTFDVAL SEELHAALSE WLTAIRAWFC EVPSS. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase TRIM31 (TRIM31), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
