CD354 recombinant protein

CD354 Recombinant Protein

Cat. Num. AAA3004334

• Gene Names: TREM1; CD354; TREM-1
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD354; CD354 Recombinant Protein; CD354 recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: ATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIRVPVFN

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 567
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD354 recombinant protein

Background: TREM-1 (triggering receptor expressed on myeloid cells-1) is expressed in monocytes and neutrophils but not in lymphocytes, dendritic cells, or other cell types. TREM-1 is a glycoprotein that is reduced by deglycosylation, in agreement with the predicted molecular mass. TREM-1 is an activating receptor of the Ig superfamily that is expressed on human myeloid cells, selectively expressed on blood neutrophils and a subset of monocytes, and is upregulated by bacterial LPS. Immunoblot analysis shows that TREM-1 is associated with DAP12, a molecule frequently associated with activating receptors. TREM-1 and the myeloid DAP12-associating lectin (MDL-1) are recently identified receptors which associate non-covalently with DAP12 to form receptor complexes that are involved in monocytic activation and inflammatory response.

NCBI and Uniprot Product Information

• NCBI GI #: 336088680
• NCBI GeneID: 54210
• NCBI Accession #: NP_001229518.1
• NCBI GenBank Nucleotide #: NM_001242589.1
• UniProt Accession #: Q9NP99; Q53FL8; Q5T2C9; Q86YU1; B4DWG2
• Molecular Weight: 26,387 Da
• NCBI Official Full Name: triggering receptor expressed on myeloid cells 1 isoform 2
• NCBI Official Synonym Full Names: triggering receptor expressed on myeloid cells 1
• NCBI Official Symbol: TREM1
• NCBI Official Synonym Symbols: CD354; TREM-1
• NCBI Protein Information: triggering receptor expressed on myeloid cells 1; triggering-receptor TREM1; triggering receptor expressed on monocytes 1
• UniProt Protein Name: Triggering receptor expressed on myeloid cells 1
• UniProt Gene Name: TREM1
• UniProt Synonym Gene Names: TREM-1
• UniProt Entry Name: TREM1_HUMAN

NCBI Description

This gene encodes a receptor belonging to the Ig superfamily that is expressed on myeloid cells. This protein amplifies neutrophil and monocyte-mediated inflammatory responses triggered by bacterial and fungal infections by stimulating release of pro-inflammatory chemokines and cytokines, as well as increased surface expression of cell activation markers. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.[provided by RefSeq, Jun 2011]

Uniprot Description

TREM1: Stimulates neutrophil and monocyte-mediated inflammatory responses. Triggers release of pro-inflammatory chemokines and cytokines, as well as increased surface expression of cell activation markers. Amplifier of inflammatory responses that are triggered by bacterial and fungal infections and is a crucial mediator of septic shock. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 6p21.1

Cellular Component: extracellular region; integral to membrane; plasma membrane

Molecular Function: receptor activity

Biological Process: neutrophil chemotaxis; innate immune response; cytokine secretion during immune response; blood coagulation; leukocyte migration; chemokine metabolic process; humoral immune response