Serine/threonine-protein kinase tricorner (trc) Recombinant Protein | trc recombinant protein
Recombinant Drosophila melanogaster Serine/threonine-protein kinase tricorner (trc)
Gene Names
trc; 0669/17; CG8637; DmelCG8637; dmTRC; l(3)76BDa; l(3)S066917; Ndr; NDR; RE-D; Trc
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Serine/threonine-protein kinase tricorner (trc); Recombinant Drosophila melanogaster Serine/threonine-protein kinase tricorner (trc); trc recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-463, Full length protein
Sequence
MMSSRTQDADGASIRFSDHTLDKATKAKVTLENYYSNLVTQYGERKQRLAKLEAQLKDESLSEAQRQEKRLQHAQKETEYLRLKRLRLGVEDFEALKVIGRGAFGEVRLVQKKDTGHVYAMKVLRKADMLEKEQVAHVRAERDVLVEADHQWVVKMYYSFQDPVNLYLIMEFLPGGDMMTLLMKKDTLSEEGTQFYISETALAIDSIHKLGFIHRDIKPDNLLLDARGHLKLSDFGLCTGLKKSHRTDFYRDLSQAKPSDFIGTCASLSCSPMDSKRRAESWKRNRRALAYSTVGTPDYIAPEVFLQTGYGPACDWWSLGVIMYEMLMGYPPFCSDNPQDTYRKVMNWRETLIFPPEIPISEEAKETIINFCCEADRRLGSQRGLEDLKSVPFFRGVDWEHIRERPAAIPVEVRSIDDTSNFDEFPDVSLEIPSAPIPQGGEIAKDWVFINYTYKRFEVRNLE
Sequence Length
463
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
53,000 Da
NCBI Official Full Name
tricornered, isoform B
NCBI Official Synonym Full Names
tricornered
NCBI Official Symbol
trc
NCBI Official Synonym Symbols
0669/17; CG8637; DmelCG8637; dmTRC; l(3)76BDa; l(3)S066917; Ndr; NDR; RE-D; Trc
NCBI Protein Information
CG8637 gene product from transcript CG8637-RB
UniProt Protein Name
Serine/threonine-protein kinase tricorner
Protein Family
UniProt Gene Name
trc
Uniprot Description
Has an important role, with fry, in controlling cell structure and proliferation of a variety of polarized outgrowths including epidermal hairs, bristles, arista laterals, and dendrites. Affects cellular morphogenesis by regulating the expression of target genes that encode cytoskeleton-interacting proteins and not via the direct modification of the cytoskeleton. Maintains the integrity of epidermal hairs and is an essential component of the signaling pathway regulating dendritic branching of sensory neurons.
Research Articles on trc
Similar Products
Product Notes
The trc trc (Catalog #AAA1307161) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-463, Full length protein. The amino acid sequence is listed below: MMSSRTQDAD GASIRFSDHT LDKATKAKVT LENYYSNLVT QYGERKQRLA KLEAQLKDES LSEAQRQEKR LQHAQKETEY LRLKRLRLGV EDFEALKVIG RGAFGEVRLV QKKDTGHVYA MKVLRKADML EKEQVAHVRA ERDVLVEADH QWVVKMYYSF QDPVNLYLIM EFLPGGDMMT LLMKKDTLSE EGTQFYISET ALAIDSIHKL GFIHRDIKPD NLLLDARGHL KLSDFGLCTG LKKSHRTDFY RDLSQAKPSD FIGTCASLSC SPMDSKRRAE SWKRNRRALA YSTVGTPDYI APEVFLQTGY GPACDWWSLG VIMYEMLMGY PPFCSDNPQD TYRKVMNWRE TLIFPPEIPI SEEAKETIIN FCCEADRRLG SQRGLEDLKS VPFFRGVDWE HIRERPAAIP VEVRSIDDTS NFDEFPDVSL EIPSAPIPQG GEIAKDWVFI NYTYKRFEVR NLE. It is sometimes possible for the material contained within the vial of "Serine/threonine-protein kinase tricorner (trc), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
