Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Thiopurine S-methyltransferase (TPMT) Recombinant Protein | TPMT recombinant protein

Recombinant Cat Thiopurine S-methyltransferase (TPMT)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Thiopurine S-methyltransferase (TPMT); Recombinant Cat Thiopurine S-methyltransferase (TPMT); TPMT recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-245, full length protein
Sequence
MDDTSTLTDVKEYPDTEVQKNRVLTLEEWREKWVDGKIGFHQEQGHQLLKKHLDTFLKGENVLRVFFPLCGKAVEMKWFADRGHCVVGVEISELGIREFFTEQNLSYSEEPIMEIPGAKVFKSSSGNISLYCCNLFDLPRVNIGKFDRIWDRGALVAVNPGDRKCYTDIMLSLTRKGFRYLLAVLSYDPTKHPGPPFYVPDAEIKNLFGSTCNIHCLEKVDVFEERHKSWGIDYIVEKLYLLTEK
Sequence Length
245
Species
Felis catus (Cat) (Felis silvestris catus)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for TPMT recombinant protein
This gene encodes the enzyme that metabolizes thiopurine drugs via S-adenosyl-L-methionine as the S-methyl donor and S-adenosyl-L-homocysteine as a byproduct. Thiopurine drugs such as 6-mercaptopurine are used as chemotherapeutic agents. Genetic polymorphisms that affect this enzymatic activity are correlated with variations in sensitivity and toxicity to such drugs within individuals. A pseudogene for this locus is located on chromosome 18q.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,321 Da
NCBI Official Full Name
thiopurine S-methyltransferase
NCBI Official Symbol
TPMT
NCBI Protein Information
thiopurine S-methyltransferase
UniProt Protein Name
Thiopurine S-methyltransferase
UniProt Gene Name
TPMT

Uniprot Description

Catalyzes the S-methylation of thiopurine drugs such as 6-mercaptopurine.

Similar Products

Product Notes

The TPMT tpmt (Catalog #AAA1286614) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-245, full length protein. The amino acid sequence is listed below: MDDTSTLTDV KEYPDTEVQK NRVLTLEEWR EKWVDGKIGF HQEQGHQLLK KHLDTFLKGE NVLRVFFPLC GKAVEMKWFA DRGHCVVGVE ISELGIREFF TEQNLSYSEE PIMEIPGAKV FKSSSGNISL YCCNLFDLPR VNIGKFDRIW DRGALVAVNP GDRKCYTDIM LSLTRKGFRY LLAVLSYDPT KHPGPPFYVP DAEIKNLFGS TCNIHCLEKV DVFEERHKSW GIDYIVEKLY LLTEK. It is sometimes possible for the material contained within the vial of "Thiopurine S-methyltransferase (TPMT), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.