Tryptophan 5-hydroxylase 1 (TPH1) Recombinant Protein | TPH1 recombinant protein
Recombinant Chicken Tryptophan 5-hydroxylase 1 (TPH1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tryptophan 5-hydroxylase 1 (TPH1); Recombinant Chicken Tryptophan 5-hydroxylase 1 (TPH1); Recombinant Tryptophan 5-hydroxylase 1 (TPH1); Tryptophan 5-hydroxylase 1 EC= 1.14.16.4; Tryptophan 5-monooxygenase 1; TPH1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-445aa; Full length protein
Sequence
MIEDNKENKDHAPERGRTAIIFSLKNEVGGLVKALKLFQEKHVNLVHIESRKSKRRNSEF EIFVDCDSNREQLNEIFQLLKSHVSIVSMNPTEHFNVQEDGDMENIPWYPKKISDLDKCA NRVLMYGSDLDADHPGFKDNVYRKRRKYFADLAMNYKHGDPIPEIEFTEEEIKTWGTVYR ELNKLYPTHACREYLKNLPLLTKYCGYREDNIPQLEDVSRFLKERTGFTIRPVAGYLSPR DFLAGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLG ASDEAVQKLATCYFFTVEFGLCKQEGQLRVYGAGLLSSISELKHSLSGSAKVKPFDPKVT CKQECLITTFQEVYFVSESFEEAKEKMREFAKTIKRPFGVKYNPYTQSVQILKDTKSIAS VVNELRHELDIVSDALSKMGKQLEV
Sequence Length
445
Species
Gallus gallus (Chicken)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51,139 Da
NCBI Official Full Name
tryptophan 5-hydroxylase 1
NCBI Official Symbol
TPH1
NCBI Protein Information
tryptophan 5-hydroxylase 1; tryptophan 5-monooxygenase 1; tryptophan hydroxylase 1 (tryptophan 5-monooxygenase)
UniProt Protein Name
Tryptophan 5-hydroxylase 1
Protein Family
UniProt Gene Name
TPH1
UniProt Synonym Gene Names
TPH
UniProt Entry Name
TPH1_CHICK
Uniprot Description
Catalytic activity: L-tryptophan + tetrahydrobiopterin + O2 = 5-hydroxy-L-tryptophan + 4a-hydroxytetrahydrobiopterin.
Cofactor: Fe2+ ion.
Pathway: Aromatic compound metabolism; serotonin biosynthesis; serotonin from L-tryptophan: step 1/2.
Subunit structure: Homotetramer. Ref.2
Sequence similarities: Belongs to the biopterin-dependent aromatic amino acid hydroxylase family.Contains 1 ACT domain.
Research Articles on TPH1
Similar Products
Product Notes
The TPH1 tph1 (Catalog #AAA959367) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-445aa; Full length protein. The amino acid sequence is listed below: MIEDNKENKD HAPERGRTAI IFSLKNEVGG LVKALKLFQE KHVNLVHIES RKSKRRNSEF EIFVDCDSNR EQLNEIFQLL KSHVSIVSMN PTEHFNVQED GDMENIPWYP KKISDLDKCA NRVLMYGSDL DADHPGFKDN VYRKRRKYFA DLAMNYKHGD PIPEIEFTEE EIKTWGTVYR ELNKLYPTHA CREYLKNLPL LTKYCGYRED NIPQLEDVSR FLKERTGFTI RPVAGYLSPR DFLAGLAFRV FHCTQYVRHS SDPLYTPEPD TCHELLGHVP LLAEPSFAQF SQEIGLASLG ASDEAVQKLA TCYFFTVEFG LCKQEGQLRV YGAGLLSSIS ELKHSLSGSA KVKPFDPKVT CKQECLITTF QEVYFVSESF EEAKEKMREF AKTIKRPFGV KYNPYTQSVQ ILKDTKSIAS VVNELRHELD IVSDALSKMG KQLEV. It is sometimes possible for the material contained within the vial of "Tryptophan 5-hydroxylase 1 (TPH1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
