Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Tumor protein D53 (TPD52L1) Recombinant Protein | TPD52L1 recombinant protein

Recombinant Human Tumor protein D53 (TPD52L1)

Gene Names
TPD52L1; D53; hD53
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tumor protein D53 (TPD52L1); Recombinant Human Tumor protein D53 (TPD52L1); Tumor protein D53; hD53; Tumor protein D52-like 1; TPD52L1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-144aa; Full Length
Sequence
MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRNSPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC
Sequence Length
204
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Product Categories/Family for TPD52L1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
49.4 kDa
NCBI Official Full Name
tumor protein D53 isoform 2
NCBI Official Synonym Full Names
tumor protein D52-like 1
NCBI Official Symbol
TPD52L1
NCBI Official Synonym Symbols
D53; hD53
NCBI Protein Information
tumor protein D53
UniProt Protein Name
Tumor protein D53
Protein Family
UniProt Gene Name
TPD52L1
UniProt Synonym Gene Names
hD53
UniProt Entry Name
TPD53_HUMAN

NCBI Description

This gene encodes a member of the tumor protein D52 (TPD52) family. The encoded protein contains a coiled-coil domain and may form homo- or hetero-dimer with TPD52 family members. The protein is reported to be involved in cell proliferation and calcium signaling. It also interacts with the mitogen-activated protein kinase kinase kinase 5 (MAP3K5/ASK1) and positively regulates MAP3K5-induced apoptosis. Multiple alternatively spliced transcript variants have been observed, but the full-length nature of some variants has not yet been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

TPD52L1: a member of the tumor protein D52 (TPD52) family. Contains a coiled-coil domain and may form homo- or hetero-dimer with TPD52 family members. The protein is reported to be involved in cell proliferation and calcium signaling. Interacts with the apoptosis signal-regulating kinase 1 (ASK1) and positively regulates ASK1-induced apoptosis. Multiple alternatively spliced transcript variants have been observed.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 6q22-q23

Cellular Component: perinuclear region of cytoplasm; cytoplasm

Molecular Function: identical protein binding; protein binding; protein homodimerization activity; protein heterodimerization activity

Biological Process: positive regulation of MAP kinase activity; positive regulation of JNK cascade; regulation of caspase activity; G2/M transition of mitotic cell cycle

Research Articles on TPD52L1

Similar Products

Product Notes

The TPD52L1 tpd52l1 (Catalog #AAA1414077) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-144aa; Full Length. The amino acid sequence is listed below: MEAQAQGLLE TEPLQGTDED AVASADFSSM LSEEEKEELK AELVQLEDEI TTLRQVLSAK ERHLVEIKQK LGMNLMNELK QNFSKSWHDM QTTTAYKKTH ETLSHAGQKA TAAFSNVGTA ISKKFGDMSY SIRHSISMPA MRNSPTFKSF EERVETTVTS LKTKVGGTNP NGGSFEEVLS STAHASAQSL AGGSRRTKEE ELQC. It is sometimes possible for the material contained within the vial of "Tumor protein D53 (TPD52L1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.