Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Tumor protein p53-inducible nuclear protein 1 (TP53INP1) Recombinant Protein | TP53INP1 recombinant protein

Recombinant Human Tumor protein p53-inducible nuclear protein 1 (TP53INP1)

Gene Names
TP53INP1; SIP; Teap; p53DINP1; TP53DINP1; TP53INP1A; TP53INP1B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tumor protein p53-inducible nuclear protein 1 (TP53INP1); Recombinant Human Tumor protein p53-inducible nuclear protein 1 (TP53INP1); TP53INP1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-240, Full length protein
Sequence
MFQRLNKMFVGEVSSSSNQEPEFNEKEDDEWILVDFIDTCTGFSAEEEEEEEDISEESPTEHPSVFSCLPASLECLADTSDSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPMENLLIEHPSMSVYAVHNSCPGLSEATRGTDELHSPSSPRVEAQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPCPRQYNY
Sequence Length
240
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,244 Da
NCBI Official Full Name
tumor protein p53-inducible nuclear protein 1 isoform b
NCBI Official Synonym Full Names
tumor protein p53 inducible nuclear protein 1
NCBI Official Symbol
TP53INP1
NCBI Official Synonym Symbols
SIP; Teap; p53DINP1; TP53DINP1; TP53INP1A; TP53INP1B
NCBI Protein Information
tumor protein p53-inducible nuclear protein 1
UniProt Protein Name
Tumor protein p53-inducible nuclear protein 1
UniProt Gene Name
TP53INP1
UniProt Synonym Gene Names
P53DINP1; SIP; p53DINP1

Uniprot Description

Antiproliferative and proapoptotic protein involved in cell stress response which acts as a dual regulator of transcription and autophagy. Acts as a positive regulator of autophagy. In response to cellular stress or activation of autophagy, relocates to autophagosomes where it interacts with autophagosome-associated proteins GABARAP, GABARAPL1/L2, MAP1LC3A/B/C and regulates autophagy. Acts as an antioxidant and plays a major role in p53/TP53-driven oxidative stress response. Possesses both a p53/TP53-independent intracellular reactive oxygen species (ROS) regulatory function and a p53/TP53-dependent transcription regulatory function. Positively regulates p53/TP53 and p73/TP73 and stimulates their capacity to induce apoptosis and regulate cell cycle. In response to double-strand DNA breaks, promotes p53/TP53 phosphorylation on 'Ser-46' and subsequent apoptosis. Acts as a tumor suppressor by inducing cell death by an autophagy and caspase-dependent mechanism. Can reduce cell migration by regulating the expression of SPARC.

Research Articles on TP53INP1

Similar Products

Product Notes

The TP53INP1 tp53inp1 (Catalog #AAA1415178) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-240, Full length protein. The amino acid sequence is listed below: MFQRLNKMFV GEVSSSSNQE PEFNEKEDDE WILVDFIDTC TGFSAEEEEE EEDISEESPT EHPSVFSCLP ASLECLADTS DSCFLQFESC PMEESWFITP PPCFTAGGLT TIKVETSPME NLLIEHPSMS VYAVHNSCPG LSEATRGTDE LHSPSSPRVE AQNEMGQHIH CYVAALAAHT TFLEQPKSFR PSQWIKEHSE RQPLNRNSLR RQNLTRDCHP RQVKHNGWVV HQPCPRQYNY. It is sometimes possible for the material contained within the vial of "Tumor protein p53-inducible nuclear protein 1 (TP53INP1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.