Outer membrane protein tolC (tolC) Recombinant Protein | tolC recombinant protein
Recombinant Escherichia coli Outer membrane protein tolC (tolC)
Gene Names
tolC; colE1-i; ECK3026; JW5503; mtcB; mukA; refI; toc; weeA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Outer membrane protein tolC (tolC); Recombinant Escherichia coli Outer membrane protein tolC (tolC); tolC recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
23-493. Mature Protein Full length
Sequence
ENLMQVYQQARLSNPELRKSAADRDAAFEKINEARSPLLPQLGLGADYTYSNGYRDANGINSNATSASLQLTQSIFDMSKWRALTLQEKAAGIQDVTYQTDQQTLILNTATAYFNVLNAIDVLSYTQAQKEAIYRQLDQTTQRFNVGLVAITDVQNARAQYDTVLANEVTARNNLDNAVEQLRQITGNYYPELAALNVENFKTDKPQPVNALLKEAEKRNLSLLQARLSQDLAREQIRQAQDGHLPTLDLTASTGISDTSYSGSKTRGAAGTQYDDSNMGQNKVGLSFSLPIYQGGMVNSQVKQAQYNFVGASEQLESAHRSVVQTVRSSFNNINASISSINAYKQAVVSAQSSLDAMEAGYSVGTRTIVDVLDATTTLYNAKQELANARYNYLINQLNIKSALGTLNEQDLLALNNALS
KPVSTNPENVAPQTPEQNAIADGYAPDSPAPVVQQTSARTTTSNGHNPFRN
Sequence Length
493
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for tolC recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
53,741 Da
NCBI Official Full Name
transport channel
NCBI Official Symbol
tolC
NCBI Official Synonym Symbols
colE1-i; ECK3026; JW5503; mtcB; mukA; refI; toc; weeA
NCBI Protein Information
transport channel
UniProt Protein Name
Outer membrane protein TolC
Protein Family
UniProt Gene Name
tolC
UniProt Synonym Gene Names
colE1-i; mtcB; mukA; refI; toc; weeA
UniProt Entry Name
TOLC_ECOLI
NCBI Description
TolC, MdtQ, MdtP and CusC are paralogs. [More information is available at EcoGene: EG11009]. TolC is an outer membrane porin involved in the efflux of several hydrophobic and amphipathic molecules. [More information is available at EcoCyc: EG11009].
Uniprot Description
Outer membrane channel, which is required for the function of several efflux systems such as AcrAB-TolC, AcrEF-TolC, EmrAB-TolC and MacAB-TolC. These systems are involved in export of antibiotics and other toxic compounds from the cell. TolC is also involved in import of colicin E1 into the cells.
Research Articles on tolC
Similar Products
Product Notes
The tolC tolc (Catalog #AAA7032059) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-493. Mature Protein Full length. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the tolC tolc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ENLMQVYQQA RLSNPELRKS AADRDAAFEK INEARSPLLP QLGLGADYTY SNGYRDANGI NSNATSASLQ LTQSIFDMSK WRALTLQEKA AGIQDVTYQT DQQTLILNTA TAYFNVLNAI DVLSYTQAQK EAIYRQLDQT TQRFNVGLVA ITDVQNARAQ YDTVLANEVT ARNNLDNAVE QLRQITGNYY PELAALNVEN FKTDKPQPVN ALLKEAEKRN LSLLQARLSQ DLAREQIRQA QDGHLPTLDL TASTGISDTS YSGSKTRGAA GTQYDDSNMG QNKVGLSFSL PIYQGGMVNS QVKQAQYNFV GASEQLESAH RSVVQTVRSS FNNINASISS INAYKQAVVS AQSSLDAMEA GYSVGTRTIV DVLDATTTLY NAKQELANAR YNYLINQLNI KSALGTLNEQ DLLALNNALS KPVSTNPE NVAPQTPEQN AIADGYAPDS PAPVVQQTSA RTTTSNGHNP FRN. It is sometimes possible for the material contained within the vial of "Outer membrane protein tolC (tolC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
