Tumor necrosis factor ligand superfamily member 11 (TNFSF11) Recombinant Protein | TNFSF11 recombinant protein

Recombinant Human Tumor necrosis factor ligand superfamily member 11 (TNFSF11), partial

Cat. Num. AAA9018633

• Gene Names: TNFSF11; ODF; OPGL; sOdf; CD254; OPTB2; RANKL; TRANCE; hRANKL2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Tumor necrosis factor ligand superfamily member 11 (TNFSF11); Recombinant Human Tumor necrosis factor ligand superfamily member 11 (TNFSF11); partial; Osteoclast differentiation factor; ODF; Osteoprotegerin ligand; OPGL; Receptor activator of nuclear factor kappa-B ligand; RANKL; TNF-related activation-induced cytokine; TRANCE; CD254; TNFSF11 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 63-244aa & linker(NKLLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLG), Partial of Isoform2
• Sequence: GSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDIDNKLLVPRGSPGSGYIPEAPRDGQAYVRKDGEWVLLSTFLG

• Species: Homo sapiens (Human)
• Relevance: Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy (PubMed:22664871). Induces osteoclastogenesis by activating multiple signaling pathways in osteoclast precursor cells, chief among which is induction of long lasting oscillations in the intracellular concentration of Ca (2+) resulting in the activation of NFATC1, which translocates to the nucleus and induces osteoclast-specific gene transcription to allow differentiation of osteoclasts. During osteoclast differentiation, in a TMEM64 and ATP2A2-dependent manner induces activation of CREB1 and mitochondrial ROS generation necessary for proper osteoclast generation.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

Product Categories/Family for TNFSF11 recombinant protein

Cardiovascular

References

"Crystal structure of human RANKL complexed with its decoy receptor osteoprotegerin."Luan X., Lu Q., Jiang Y., Zhang S., Wang Q., Yuan H., Zhao W., Wang J., Wang X.J. Immunol. 189:245-252(2012)

NCBI and Uniprot Product Information

• NCBI GI #: 4507595
• NCBI GeneID: 8600
• NCBI Accession #: NP_003692.1
• NCBI GenBank Nucleotide #: NM_003701.3
• UniProt Accession #: O14788; O14723; Q96Q17; Q9P2Q3
• Molecular Weight: 35,478 Da
• NCBI Official Full Name: tumor necrosis factor ligand superfamily member 11 isoform 1
• NCBI Official Synonym Full Names: tumor necrosis factor (ligand) superfamily, member 11
• NCBI Official Symbol: TNFSF11
• NCBI Official Synonym Symbols: ODF; OPGL; sOdf; CD254; OPTB2; RANKL; TRANCE; hRANKL2
• NCBI Protein Information: tumor necrosis factor ligand superfamily member 11; osteoprotegerin ligand; osteoclast differentiation factor; TNF-related activation-induced cytokine; receptor activator of nuclear factor kappa B ligand; receptor activator of nuclear factor kappa-B ligan
• UniProt Protein Name: Tumor necrosis factor ligand superfamily member 11
• Protein Family: Tumor necrosis factor ligand superfamily
• UniProt Gene Name: TNFSF11
• UniProt Synonym Gene Names: OPGL; RANKL; TRANCE; ODF; OPGL; RANKL; TRANCE
• UniProt Entry Name: TNF11_HUMAN

NCBI Description

This gene encodes a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. This protein was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. Targeted disruption of the related gene in mice led to severe osteopetrosis and a lack of osteoclasts. The deficient mice exhibited defects in early differentiation of T and B lymphocytes, and failed to form lobulo-alveolar mammary structures during pregnancy. Two alternatively spliced transcript variants have been found. [provided by RefSeq, Jul 2008]

Uniprot Description

TNFSF11: Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy. Homotrimer. Up-regulated by T-cell receptor stimulation. Highest in the peripheral lymph nodes, weak in spleen, peripheral blood Leukocytes, bone marrow, heart, placenta, skeletal muscle, stomach and thyroid. Belongs to the tumor necrosis factor family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 13q14

Cellular Component: extracellular space; integral to plasma membrane; cytoplasm; extracellular region

Molecular Function: cytokine activity; tumor necrosis factor receptor superfamily binding; tumor necrosis factor receptor binding

Biological Process: ossification; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of osteoclast differentiation; cytokine and chemokine mediated signaling pathway; mammary gland epithelial cell proliferation; osteoclast differentiation; activation of JNK activity; positive regulation of homotypic cell-cell adhesion; positive regulation of corticotropin-releasing hormone secretion; activation of NF-kappaB transcription factor; calcium ion homeostasis; positive regulation of protein kinase B signaling cascade; positive regulation of MAP kinase activity; monocyte chemotaxis; organ morphogenesis; tumor necrosis factor-mediated signaling pathway; positive regulation of bone resorption; positive regulation of transcription factor activity; immune response; positive regulation of transcription from RNA polymerase II promoter; positive regulation of T cell activation; protein homooligomerization; bone resorption

Disease: Osteopetrosis, Autosomal Recessive 2