Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Tumor necrosis factor ligand superfamily member 11 Recombinant Protein | Tnfsf11 recombinant protein

Tumor necrosis factor ligand superfamily member 11

Gene Names
Tnfsf11; ODF; OPG; OPGL; RANKL; Ly109l; Trance
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tumor necrosis factor ligand superfamily member 11; Tnfsf11 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-316aa; full length protein
Sequence
MRRASRDYGKYLRSSEEMGSGPGVPHEGPLHPAPSAPAPAPPPAASRSMFLALLGLGLGQVVCSIALFLYFRAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
Sequence Length
Full Length Protein
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Tnfsf11 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Tnfsf11 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,150 Da
NCBI Official Full Name
tumor necrosis factor ligand superfamily member 11
NCBI Official Synonym Full Names
tumor necrosis factor (ligand) superfamily, member 11
NCBI Official Symbol
Tnfsf11
NCBI Official Synonym Symbols
ODF; OPG; OPGL; RANKL; Ly109l; Trance
NCBI Protein Information
tumor necrosis factor ligand superfamily member 11
UniProt Protein Name
Tumor necrosis factor ligand superfamily member 11
UniProt Gene Name
Tnfsf11
UniProt Synonym Gene Names
Opgl; Rankl; Trance; ODF; OPGL; RANKL; TRANCE
UniProt Entry Name
TNF11_MOUSE

Uniprot Description

TNFSF11: Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy. Homotrimer. Up-regulated by T-cell receptor stimulation. Highest in the peripheral lymph nodes, weak in spleen, peripheral blood Leukocytes, bone marrow, heart, placenta, skeletal muscle, stomach and thyroid. Belongs to the tumor necrosis factor family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Molecular Function: cytokine activity; protein binding; tumor necrosis factor receptor superfamily binding

Biological Process: activation of JNK activity; activation of NF-kappaB transcription factor; bone resorption; calcium ion homeostasis; cytokine and chemokine mediated signaling pathway; lymph node development; mammary gland epithelial cell proliferation; monocyte chemotaxis; organ morphogenesis; ossification; osteoclast differentiation; positive regulation of bone resorption; positive regulation of corticotropin-releasing hormone secretion; positive regulation of homotypic cell-cell adhesion; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of JNK cascade; positive regulation of MAP kinase activity; positive regulation of osteoclast differentiation; positive regulation of phosphorylation; positive regulation of protein kinase B signaling cascade; positive regulation of T cell activation; positive regulation of transcription factor activity; positive regulation of transcription from RNA polymerase II promoter; protein homooligomerization; regulation of osteoclast differentiation; tumor necrosis factor-mediated signaling pathway

Research Articles on Tnfsf11

Similar Products

Product Notes

The Tnfsf11 tnfsf11 (Catalog #AAA7043496) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-316aa; full length protein. The amino acid sequence is listed below: MRRASRDYGK YLRSSEEMGS GPGVPHEGPL HPAPSAPAPA PPPAASRSMF LALLGLGLGQ VVCSIALFLY FRAQMDPNRI SEDSTHCFYR ILRLHENADL QDSTLESEDT LPDSCRRMKQ AFQGAVQKEL QHIVGPQRFS GAPAMMEGSW LDVAQRGKPE AQPFAHLTIN AASIPSGSHK VTLSSWYHDR GWAKISNMTL SNGKLRVNQD GFYYLYANIC FRHHETSGSV PTDYLQLMVY VVKTSIKIPS SHNLMKGGST KNWSGNSEFH FYSINVGGFF KLRAGEEISI QVSNPSLLDP DQDATYFGAF KVQDID. It is sometimes possible for the material contained within the vial of "Tumor necrosis factor ligand superfamily member 11, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.