Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201240_WB13.jpg WB (Western Blot) (WB Suggested Anti-EPHA7 AntibodyTitration: 1.0 ug/mlPositive Control: OVCAR-3 Whole CellEPHA7 is supported by BioGPS gene expression data to be expressed in OVCAR3)

Rabbit EPHA7 Polyclonal Antibody | anti-EPHA7 antibody

EPHA7 Antibody - C-terminal region

Gene Names
EPHA7; EHK3; EK11; EHK-3; HEK11
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EPHA7, Antibody; EPHA7 Antibody - C-terminal region; anti-EPHA7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGIL
Sequence Length
998
Applicable Applications for anti-EPHA7 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human EPHA7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-EPHA7 AntibodyTitration: 1.0 ug/mlPositive Control: OVCAR-3 Whole CellEPHA7 is supported by BioGPS gene expression data to be expressed in OVCAR3)

product-image-AAA201240_WB13.jpg WB (Western Blot) (WB Suggested Anti-EPHA7 AntibodyTitration: 1.0 ug/mlPositive Control: OVCAR-3 Whole CellEPHA7 is supported by BioGPS gene expression data to be expressed in OVCAR3)

WB (Western Blot)

(Host: RabbitTarget Name: EPHA7Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA201240_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: EPHA7Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-EPHA7 antibody
This is a rabbit polyclonal antibody against EPHA7. It was validated on Western Blot

Target Description: This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands.
Product Categories/Family for anti-EPHA7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
112kDa
NCBI Official Full Name
ephrin type-A receptor 7 isoform 1
NCBI Official Synonym Full Names
EPH receptor A7
NCBI Official Symbol
EPHA7
NCBI Official Synonym Symbols
EHK3; EK11; EHK-3; HEK11
NCBI Protein Information
ephrin type-A receptor 7
UniProt Protein Name
Ephrin type-A receptor 7
UniProt Gene Name
EPHA7
UniProt Synonym Gene Names
EHK3; HEK11; EHK-3; EK11; hEK11
UniProt Entry Name
EPHA7_HUMAN

Similar Products

Product Notes

The EPHA7 epha7 (Catalog #AAA201240) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EPHA7 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's EPHA7 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the EPHA7 epha7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SNQDVIKAIE EGYRLPAPMD CPAGLHQLML DCWQKERAER PKFEQIVGIL. It is sometimes possible for the material contained within the vial of "EPHA7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.