Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Transmembrane protein 50B (TMEM50B) Recombinant Protein | TMEM50B recombinant protein

Recombinant Human Transmembrane protein 50B (TMEM50B)

Gene Names
TMEM50B; C21orf4; HCVP7TP3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transmembrane protein 50B (TMEM50B); Recombinant Human Transmembrane protein 50B (TMEM50B); Recombinant Transmembrane protein 50B (TMEM50B); Transmembrane protein 50B; HCV p7-trans-regulated protein 3; TMEM50B recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-158
Sequence
MAGFLDNFRWPECECIDWSERRNAVASVVAGILFFTGWWIMIDAAVVYPKPEQLNHAFHTCGVFSTLAFFMINAVSNAQVRGDSYESGCLGRTGARVWLFIGFMLMFGSLIASMWILFGAYVTQNTDVYPGLAVFFQNALIFFSTLIYKFGRTEELWT
Sequence Length
158
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
757
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,936 Da
NCBI Official Full Name
transmembrane protein 50B
NCBI Official Synonym Full Names
transmembrane protein 50B
NCBI Official Symbol
TMEM50B
NCBI Official Synonym Symbols
C21orf4; HCVP7TP3
NCBI Protein Information
transmembrane protein 50B; HCV p7-transregulated protein 3; HCV p7-trans-regulated protein 3
UniProt Protein Name
Transmembrane protein 50B
Protein Family
UniProt Gene Name
TMEM50B
UniProt Synonym Gene Names
C21orf4
UniProt Entry Name
TM50B_HUMAN

Uniprot Description

TMEM50B: Belongs to the UPF0220 family

Protein type: Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 21q22.11

Cellular Component: endoplasmic reticulum; plasma membrane; integral to membrane

Similar Products

Product Notes

The TMEM50B tmem50b (Catalog #AAA966043) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-158. The amino acid sequence is listed below: MAGFLDNFRW PECECIDWSE RRNAVASVVA GILFFTGWWI MIDAAVVYPK PEQLNHAFHT CGVFSTLAFF MINAVSNAQV RGDSYESGCL GRTGARVWLF IGFMLMFGSL IASMWILFGA YVTQNTDVYP GLAVFFQNAL IFFSTLIYKF GRTEELWT. It is sometimes possible for the material contained within the vial of "Transmembrane protein 50B (TMEM50B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.