Transmembrane protein 173 (tmem173) Recombinant Protein | tmem173 recombinant protein
Recombinant Xenopus tropicalis Transmembrane protein 173 (tmem173)
Gene Names
tmem173; STING
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transmembrane protein 173 (tmem173); Recombinant Xenopus tropicalis Transmembrane protein 173 (tmem173); Recombinant Transmembrane protein 173 (tmem173); Transmembrane protein 173; Stimulator of interferon genes protein; STING; tmem173 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-329
Sequence
MACVLAIGSILFVWILGKGKYSGAQLIYRMATNFAISQGCCLVTCACELTEEIKHLHTRYNGHYWRALKASFNLSCAAFVTAILCYVFYEPKLMASLPLTIDITLTLLSWLFCWILGIQGPTPATISEITEIKQLNVAHGLAWSYYVGYLQFVLPALKESIQKFNEENHNLLKFPETCRLHILIPLSCRLYGDLKDVDENITFLKEIPPLYIDRAGIKGRVFKNNVYRILDEDGRPYNCIVEYATPLASLLKMTDIPSAAFSADDRLQQTKLFYRTLKDILENAHELQNTYRLIVYEDFPETKDHSRHLLSQEILKHIRQQHSEEYSML
Sequence Length
329
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,815 Da
NCBI Official Full Name
transmembrane protein 173
NCBI Official Synonym Full Names
transmembrane protein 173
NCBI Official Symbol
tmem173
NCBI Official Synonym Symbols
STING
NCBI Protein Information
transmembrane protein 173; stimulator of interferon genes protein
UniProt Protein Name
Transmembrane protein 173
Protein Family
UniProt Gene Name
tmem173
UniProt Synonym Gene Names
sting; STING
UniProt Entry Name
TM173_XENTR
Uniprot Description
Function: Facilitator of innate immune signaling that promotes the production of type I interferon (IFN-alpha and IFN-beta). Innate immune response is triggered in response to non-CpG double-stranded DNA from viruses and bacteria delivered to the cytoplasm. Able to activate both NF-kappa-B and IRF3 transcription pathways to induce expression of type I interferon and exert a potent anti-viral state following expression. May be involved in transduction of apoptotic signals via its association with the major histocompatibility complex class II (MHC-II)
By similarity.
Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Mitochondrion outer membrane; Multi-pass membrane protein
By similarity.
Sequence similarities: Belongs to the TMEM173 family.
Similar Products
Product Notes
The tmem173 tmem173 (Catalog #AAA1154354) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-329. The amino acid sequence is listed below: MACVLAIGSI LFVWILGKGK YSGAQLIYRM ATNFAISQGC CLVTCACELT EEIKHLHTRY NGHYWRALKA SFNLSCAAFV TAILCYVFYE PKLMASLPLT IDITLTLLSW LFCWILGIQG PTPATISEIT EIKQLNVAHG LAWSYYVGYL QFVLPALKES IQKFNEENHN LLKFPETCRL HILIPLSCRL YGDLKDVDEN ITFLKEIPPL YIDRAGIKGR VFKNNVYRIL DEDGRPYNCI VEYATPLASL LKMTDIPSAA FSADDRLQQT KLFYRTLKDI LENAHELQNT YRLIVYEDFP ETKDHSRHLL SQEILKHIRQ QHSEEYSML. It is sometimes possible for the material contained within the vial of "Transmembrane protein 173 (tmem173), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
