Transmembrane protein 17B (Tmem17-b) Recombinant Protein | tmem17 recombinant protein

Recombinant Xenopus tropicalis Transmembrane protein 17B (Tmem17-b)

• Gene Names: tmem17; Tmem17-b
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Transmembrane protein 17B (Tmem17-b); Recombinant Xenopus tropicalis Transmembrane protein 17B (Tmem17-b); tmem17 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-219
• Sequence: MALLTPLPGSVRHGLARISGSLFIQNKTRDCGEQHAYQSGHDLLSSLPLQMMLYFNAFFFPFWIISEIITMELKFGRLSGYYQILLTTSLVILTLVESLRLYIGYVGNLHEKVPELAGFLILTLLIQLPLLLFLLTDNRNLLLPLDLAVHMIYLMFINAEIVISFLVLKTMTRQFALEYYLQQSEILVSKHVPVNRTLLRFQNTTTSIAEQYGSDALMY
• Sequence Length: 219

• Species: Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

Related Product Information for tmem17 recombinant protein

Tmem17-b

NCBI and Uniprot Product Information

• NCBI GI #: 301604210
• NCBI GeneID: 100124937
• NCBI Accession #: XP_002931754.1
• NCBI GenBank Nucleotide #: XM_002931708.1
• UniProt Accession #: F6RWY9; A4II27
• Molecular Weight: 25,067 Da
• NCBI Official Full Name: transmembrane protein 17
• NCBI Official Symbol: tmem17
• NCBI Official Synonym Symbols: Tmem17-b
• NCBI Protein Information: transmembrane protein 17; Transmembrane protein 17B
• UniProt Protein Name: Transmembrane protein 17B
• Protein Family: Transmembrane protein
• UniProt Gene Name: Tmem17-b
• UniProt Entry Name: TM17B_XENTR

Uniprot Description

Function: Transmembrane component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. Required for ciliogenesis and sonic hedgehog/SHH signaling

By similarity.

Subunit structure: Part of the tectonic-like complex (also named B9 complex)

By similarity.

Subcellular location: Cell projection › cilium membrane; Multi-pass membrane protein

By similarity. Note: Localizes to the transition zone of primary cilia

By similarity.

Sequence similarities: Belongs to the TMEM17 family.

Sequence caution: The sequence AAI35818.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.