Toll-like receptor 1 (TLR1) Recombinant Protein | TLR1 recombinant protein

Recombinant Human Toll-like receptor 1 (TLR1), partial

Cat. Num. AAA1413129

• Gene Names: TLR1; TIL; CD281; rsc786; TIL. LPRS5
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Toll-like receptor 1 (TLR1); Recombinant Human Toll-like receptor 1 (TLR1); partial; TLR1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 25-580. Partial
• Sequence: SEFLVDRSKNGLIHVPKDLSQKTTILNISQNYISELWTSDILSLSKLRILIISHNRIQYLDISVFKFNQELEYLDLSHNKLVKISCHPTVNLKHLDLSFNAFDALPICKEFGNMSQLKFLGLSTTHLEKSSVLPIAHLNISKVLLVLGETYGEKEDPEGLQDFNTESLHIVFPTNKEFHFILDVSVKTVANLELSNIKCVLEDNKCSYFLSILAKLQTNPKLSNLTLNNIETTWNSFIRILQLVWHTTVWYFSISNVKLQGQLDFRDFDYSGTSLKALSIHQVVSDVFGFPQSYIYEIFSNMNIKNFTVSGTRMVHMLCPSKISPFLHLDFSNNLLTDTVFENCGHLTELETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNSVSYDEKKGDCSWTKSLLSLNMSSNILTDTIFRCLPPRIKVLDLHSNKIKSIPKQVVKLEALQELNVAFNSLTDLPGCGSFSSLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELGEFVKNIDQVSSEVLEGWPDSYKCDYPESYRGTLLKDFHMSELSCNIT

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 41350337
• NCBI GeneID: 7096
• NCBI Accession #: NP_003254.2
• NCBI GenBank Nucleotide #: NM_003263.3
• UniProt Accession #: Q15399; O15452; Q32MK3; Q32MK4; Q9UG90; D1CS39; D1CS41
• Molecular Weight: 65.2 kDa
• NCBI Official Full Name: toll-like receptor 1
• NCBI Official Synonym Full Names: toll like receptor 1
• NCBI Official Symbol: TLR1
• NCBI Official Synonym Symbols: TIL; CD281; rsc786; TIL. LPRS5
• NCBI Protein Information: toll-like receptor 1
• UniProt Protein Name: Toll-like receptor 1
• Protein Family: Toll-like receptor
• UniProt Gene Name: TLR1
• UniProt Synonym Gene Names: KIAA0012; TIL

NCBI Description

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is ubiquitously expressed, and at higher levels than other TLR genes. Different length transcripts presumably resulting from use of alternative polyadenylation site, and/or from alternative splicing, have been noted for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Participates in the innate immune response to microbial agents. Specifically recognizes diacylated and triacylated lipopeptides. Cooperates with TLR2 to mediate the innate immune response to bacterial lipoproteins or lipopeptides (PubMed:21078852). Forms the activation cluster TLR2:TLR1:CD14 in response to triacylated lipopeptides, this cluster triggers signaling from the cell surface and subsequently is targeted to the Golgi in a lipid-raft dependent pathway (PubMed:16880211). Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.