mRNA decay factor CTH2 (TIS11) Recombinant Protein | TIS11 recombinant protein
Recombinant Saccharomyces cerevisiae mRNA decay factor CTH2 (TIS11)
Gene Names
TIS11; CTH2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
mRNA decay factor CTH2 (TIS11); Recombinant Saccharomyces cerevisiae mRNA decay factor CTH2 (TIS11); TIS11 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-285, full length protein
Sequence
MWAQLSYTRPESQKTDLTSLFSTDQEQNPLNDYQYQINIRELEEYYNKTILNEDNIQETSSEISSAVSFSPPKNTNAIQPGLLYDPQLMNPFLPSAHLNSTAPTTFKKKLEVQINPDYVPKSSQLPLTSQNLQQLSQQKPKNDASFSSEKESSAQPKVKSQVQETPKQLYKTELCESFTLKGSCPYGSKCQFAHGLGELKVKKSCKNFRTKPCVNWEKLGYCPYGRRCCFKHGDDNDIAVYVKAGTYCNVSSTSKQSDEKRSNGRGSAKKKNLNVKVKALQRMTW
Sequence Length
285
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
32,314 Da
NCBI Official Full Name
Tis11p
NCBI Official Symbol
TIS11
NCBI Official Synonym Symbols
CTH2
NCBI Protein Information
Tis11p
UniProt Protein Name
mRNA decay factor CTH2
Protein Family
UniProt Gene Name
TIS11
UniProt Synonym Gene Names
CTH2
Uniprot Description
Binds to specific AU-rich elements (ARE) in the 3'-untranslated region of target mRNAs and promotes their degradation. In response to iron deficiency, promotes the decay of many mRNAs encoding proteins involved in iron-dependent pathways. Recruits the DHH1 helicase to the SDH4 mRNA and promotes SDH4 mRNA decay. Also destabilizes target mRNA by modulating 3'-end processing, creating extended transcripts that are prone for degradation.
Research Articles on TIS11
Similar Products
Product Notes
The TIS11 tis11 (Catalog #AAA1176049) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-285, full length protein. The amino acid sequence is listed below: MWAQLSYTRP ESQKTDLTSL FSTDQEQNPL NDYQYQINIR ELEEYYNKTI LNEDNIQETS SEISSAVSFS PPKNTNAIQP GLLYDPQLMN PFLPSAHLNS TAPTTFKKKL EVQINPDYVP KSSQLPLTSQ NLQQLSQQKP KNDASFSSEK ESSAQPKVKS QVQETPKQLY KTELCESFTL KGSCPYGSKC QFAHGLGELK VKKSCKNFRT KPCVNWEKLG YCPYGRRCCF KHGDDNDIAV YVKAGTYCNV SSTSKQSDEK RSNGRGSAKK KNLNVKVKAL QRMTW. It is sometimes possible for the material contained within the vial of "mRNA decay factor CTH2 (TIS11), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
