Probable aquaporin TIP1-1 (TIP1-1) Recombinant Protein | Os03g0146100 recombinant protein
Recombinant Oryza sativa subsp. japonica Probable aquaporin TIP1-1 (TIP1-1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable aquaporin TIP1-1 (TIP1-1); Recombinant Oryza sativa subsp. japonica Probable aquaporin TIP1-1 (TIP1-1); Recombinant Probable aquaporin TIP1-1 (TIP1-1); Probable aquaporin TIP1-1; Tonoplast intrinsic protein 1-1; OsTIP1;1 rTIP1; Os03g0146100 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-250
Sequence
MPIRNIAVGSHQEVYHPGALKAALAEFISTLIFVFAGQGSGMAFSKLTGGGATTPAGLIAAAVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWIAQLLGSTVACFLLRFSTGGLATGTFGLTGVSVWEALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGFIVGANILVGGAFDGASMNPAVSFGPALVSWSWESQWVYWVGPLIGGGLAGVIYEVLFISHTHEQLPTTDY
Sequence Length
196
Species
Oryza sativa subsp. japonica (Rice)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
25,700 Da
NCBI Official Full Name
Os03g0146100
NCBI Official Symbol
Os03g0146100
NCBI Protein Information
Os03g0146100; hypothetical protein
UniProt Protein Name
Probable aquaporin TIP1-1
UniProt Gene Name
TIP1-1
UniProt Synonym Gene Names
YK333; OsTIP1;1
UniProt Entry Name
TIP11_ORYSJ
Uniprot Description
Function: Aquaporins facilitate the transport of water and small neutral solutes across cell membranes. May be involved in transport from the vacuolar compartment to the cytoplasm
By similarity.
Subcellular location: Vacuole membrane; Multi-pass membrane protein
By similarity. Note: Tonoplast.
Tissue specificity: Expressed in roots and leaves. Ref.1 Ref.7
Induction: By osmotic stress and abscisic acid (ABA). Down-regulated by chilling. Ref.1 Ref.7
Domain: Aquaporins contain two tandem repeats each containing three membrane-spanning domains and a pore-forming loop with the signature motif Asn-Pro-Ala (NPA).
Sequence similarities: Belongs to the MIP/aquaporin (TC 1.A.8) family. TIP (TC 1.A.8.10) subfamily. [View classification]
Similar Products
Product Notes
The Os03g0146100 tip1-1 (Catalog #AAA1034001) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-250. The amino acid sequence is listed below: MPIRNIAVGS HQEVYHPGAL KAALAEFIST LIFVFAGQGS GMAFSKLTGG GATTPAGLIA AAVAHAFALF VAVSVGANIS GGHVNPAVTF GAFVGGNITL FRGLLYWIAQ LLGSTVACFL LRFSTGGLAT GTFGLTGVSV WEALVLEIVM TFGLVYTVYA TAVDPKKGSL GTIAPIAIGF IVGANILVGG AFDGASMNPA VSFGPALVSW SWESQWVYWV GPLIGGGLAG VIYEVLFISH THEQLPTTDY. It is sometimes possible for the material contained within the vial of "Probable aquaporin TIP1-1 (TIP1-1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
