Muscle-specific homeobox protein tinman (tin) Recombinant Protein | tin recombinant protein
Recombinant Drosophila melanogaster Muscle-specific homeobox protein tinman (tin)
Gene Names
tin; CG7895; DmelCG7895; DmNK-4; DROHOXHK4; DROHOXNK4; HOX; msh-2; msh2; NK-4; NK-4/msh-2; NK4; NK4/msh-2; NKX2.5; Tin; TIN; tin/NK4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Muscle-specific homeobox protein tinman (tin); Recombinant Drosophila melanogaster Muscle-specific homeobox protein tinman (tin); tin recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-416, Full length protein
Sequence
MLQHHQQQAQSGGYYDHYTQSPSPGSLTNADALNTTPFSVKDILNMVNQTEAYEGSYGHIDGAATASALFAAGEYQNPHQYLNHQQHQQSELPIPQQQLHHQHLDDGATTSSSLSPLLPPPPHQLYGGYQDYGMPAHMFQHHHGHPHQSFQHSASAYNMSASQFYAGASATAYQTPATYNYNYAGSGEVYGGATPSAVGIKSEYIPTPYVTPSPTLDLNSSAEVDSLQAPTQKLCVNPLSQRLMETASNSSSLRSIYGSDEGAKKKDNSQVTSSRSELRKNSISGNSNPGSNSGSTKPRMKRKPRVLFSQAQVLELECRFRLKKYLTGAEREIIAQKLNLSATQVKIWFQNRRYKSKRGDIDCEGIAKHLKLKSEPLDSPTSLPPPIPNHVMWPPTMQQSQQQQQHHAQQQQMQHM
Sequence Length
416
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
46,066 Da
NCBI Official Full Name
tinman
NCBI Official Synonym Full Names
tinman
NCBI Official Symbol
tin
NCBI Official Synonym Symbols
CG7895; DmelCG7895; DmNK-4; DROHOXHK4; DROHOXNK4; HOX; msh-2; msh2; NK-4; NK-4/msh-2; NK4; NK4/msh-2; NKX2.5; Tin; TIN; tin/NK4
NCBI Protein Information
CG7895 gene product from transcript CG7895-RA
UniProt Protein Name
Muscle-specific homeobox protein tinman
Protein Family
UniProt Gene Name
tin
UniProt Synonym Gene Names
msh2
Uniprot Description
Required for the development of heart and visceral muscle; for the formation of somatic muscles. Has a crucial function in the early mesodermal subdivisions.
Research Articles on tin
Similar Products
Product Notes
The tin tin (Catalog #AAA1244731) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-416, Full length protein. The amino acid sequence is listed below: MLQHHQQQAQ SGGYYDHYTQ SPSPGSLTNA DALNTTPFSV KDILNMVNQT EAYEGSYGHI DGAATASALF AAGEYQNPHQ YLNHQQHQQS ELPIPQQQLH HQHLDDGATT SSSLSPLLPP PPHQLYGGYQ DYGMPAHMFQ HHHGHPHQSF QHSASAYNMS ASQFYAGASA TAYQTPATYN YNYAGSGEVY GGATPSAVGI KSEYIPTPYV TPSPTLDLNS SAEVDSLQAP TQKLCVNPLS QRLMETASNS SSLRSIYGSD EGAKKKDNSQ VTSSRSELRK NSISGNSNPG SNSGSTKPRM KRKPRVLFSQ AQVLELECRF RLKKYLTGAE REIIAQKLNL SATQVKIWFQ NRRYKSKRGD IDCEGIAKHL KLKSEPLDSP TSLPPPIPNH VMWPPTMQQS QQQQQHHAQQ QQMQHM. It is sometimes possible for the material contained within the vial of "Muscle-specific homeobox protein tinman (tin), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
