Mitochondrial import inner membrane translocase subunit TIM23 (TIM23) Recombinant Protein | TIM23 recombinant protein

Recombinant Saccharomyces cerevisiae Mitochondrial import inner membrane translocase subunit TIM23 (TIM23)

• Gene Names: TIM23; MAS6; MIM23; MPI3
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Mitochondrial import inner membrane translocase subunit TIM23 (TIM23); Recombinant Saccharomyces cerevisiae Mitochondrial import inner membrane translocase subunit TIM23 (TIM23); Recombinant Mitochondrial import inner membrane translocase subunit TIM23 (TIM23); Mitochondrial import inner membrane translocase subunit TIM23; Membrane import machinery protein MIM23 Mitochondrial protein import protein 3 Mitochondrial protein import p; TIM23 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-222
• Sequence: MSWLFGDKTPTDDANAAVGGQDTTKPKELSLKQSLGFEPNINNIISGPGGMHVDTARLHPLAGLDKGVEYLDLEEEQLSSLEGSQGLIPSRGWTDDLCYGTGAVYLLGLGIGGFSGMMQGLQNIPPNSPGKLQLNTVLNHITKRGPFLGNNAGILALSYNIINSTIDALRGKHDTAGSIGAGALTGALFKSSKGLKPMGYSSAMVAAACAVWCSVKKRLLEK
• Sequence Length: 222

• Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 398365641
• NCBI GeneID: 855751
• NCBI Accession #: NP_014414.3
• NCBI GenBank Nucleotide #: NM_001183194.3
• UniProt Accession #: P32897; D6W1J2
• Molecular Weight: 23,244 Da
• NCBI Official Full Name: Tim23p
• NCBI Official Symbol: TIM23
• NCBI Official Synonym Symbols: MAS6; MIM23; MPI3
• NCBI Protein Information: Tim23p
• UniProt Protein Name: Mitochondrial import inner membrane translocase subunit TIM23
• UniProt Gene Name: TIM23
• UniProt Synonym Gene Names: MAS6; MIM23; MPI3
• UniProt Entry Name: TIM23_YEAST

Uniprot Description

Function: Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

Subunit structure: Component of the TIM23 complex, at least composed of TIM23, TIM17, TIM50 and TIM21. The complex interacts with the TIM44 component of the PAM complex. Ref.8

Subcellular location: Mitochondrion inner membrane; Multi-pass membrane protein. Note: Around 20 amino acids of the N-terminus are believed to span the mitochondrial outer membrane. This association is dynamic and depends on the translocation activity of the TIM23 complex. However, this topology seems not to be critical for formation of a TOM-TIM supercomplex and preprotein import. Ref.9

Miscellaneous: Present with 1440 molecules/cell in log phase SD medium.

Sequence similarities: Belongs to the Tim17/Tim22/Tim23 family.