Mitochondrial import inner membrane translocase subunit tim22 (tim22) Recombinant Protein | tim22 recombinant protein
Recombinant Schizosaccharomyces pombe Mitochondrial import inner membrane translocase subunit tim22 (tim22)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mitochondrial import inner membrane translocase subunit tim22 (tim22); Recombinant Schizosaccharomyces pombe Mitochondrial import inner membrane translocase subunit tim22 (tim22); Recombinant Mitochondrial import inner membrane translocase subunit tim22 (tim22); Mitochondrial import inner membrane translocase subunit tim22; tim22 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-175
Sequence
MSLSGLLPPNLGGNSPNADGNLTPEEKAALQQAKIIGYMNRISESCVFKSSMAGVLGFGLGGIFGMFISSLDLQHIDPKIYEKPFREQIRIQARDMGSRSFSTAKNFGLLGLIYSGSECCIEAFRAKTDIYNAIAAGVFTGGALAVRSGPKAIVLGGAGFGLFSYGIEKYMHWGE
Sequence Length
175
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,641 Da
NCBI Official Full Name
TIM22 inner membrane protein import complex subunit Tim22 (predicted)
NCBI Official Symbol
tim22
NCBI Protein Information
TIM22 inner membrane protein import complex subunit Tim22 (predicted)
UniProt Protein Name
Mitochondrial import inner membrane translocase subunit tim22
UniProt Gene Name
tim22
UniProt Entry Name
TIM22_SCHPO
Uniprot Description
Function: Essential core component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. In the TIM22 complex, it constitutes the voltage-activated and signal-gated channel. Forms a twin-pore translocase that uses the membrane potential as external driving force in 2 voltage-dependent steps
By similarity.
Subunit structure: Component of the TIM22 complex, whose core is composed of TIM22 and TIM54, associated with the 70 kDa heterohexamer composed of TIM9 and TIM10 (or TIM8 and TIM13)
By similarity.
Subcellular location: Mitochondrion inner membrane; Multi-pass membrane protein
By similarity.
Sequence similarities: Belongs to the Tim17/Tim22/Tim23 family.
Similar Products
Product Notes
The tim22 tim22 (Catalog #AAA1242562) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-175. The amino acid sequence is listed below: MSLSGLLPPN LGGNSPNADG NLTPEEKAAL QQAKIIGYMN RISESCVFKS SMAGVLGFGL GGIFGMFISS LDLQHIDPKI YEKPFREQIR IQARDMGSRS FSTAKNFGLL GLIYSGSECC IEAFRAKTDI YNAIAAGVFT GGALAVRSGP KAIVLGGAGF GLFSYGIEKY MHWGE. It is sometimes possible for the material contained within the vial of "Mitochondrial import inner membrane translocase subunit tim22 (tim22), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
