Protein TIFY 4A (TIFY4A) Recombinant Protein | TIFY4A recombinant protein
Recombinant Arabidopsis thaliana Protein TIFY 4A (TIFY4A)
Gene Names
PPD1; PEAPOD 1; PLANT-SPECIFIC PUTATIVE DNA-BINDING PROTEIN 1; TIFY4A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein TIFY 4A (TIFY4A); Recombinant Arabidopsis thaliana Protein TIFY 4A (TIFY4A); TIFY4A recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-313, Full length protein
Sequence
MDVGVSPAKSILAKPLKLLTEEDISQLTREDCRKFLKDKGMRRPSWNKSQAIQQVLSLKALYEPGDDSGAGIFRKILVSQPVNPPRVTTTLIEPSNELEACGRVSYPEDNGACHRMDSPRSAEFSGGSGHFVSEKDGHKTTISPRSPAETSELVGQMTIFYSGKVNVYDGIPPEKARSIMHFAANPIDLPENGIFASSRMISKLISKEKMMELPQKGLEKANSSRDSGMEGQANRKVSLQRYREKRKDRKFSKAKKCPGVASSSLEMFLNCQPRMKAAYSQNLGCTGSPLHSQSPESQTKSPNLSVDLNSEGI
Sequence Length
313
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
34,423 Da
NCBI Official Full Name
TIFY domain/Divergent CCT motif family protein
NCBI Official Symbol
PPD1
NCBI Official Synonym Symbols
PEAPOD 1; PLANT-SPECIFIC PUTATIVE DNA-BINDING PROTEIN 1; TIFY4A
NCBI Protein Information
TIFY domain/Divergent CCT motif family protein
UniProt Protein Name
Protein TIFY 4A
Protein Family
UniProt Gene Name
TIFY4A
UniProt Synonym Gene Names
PPD1
NCBI Description
PPD1 (and its paralog, PPD2) encode plant-specific putative DNA-binding proteins. PPD1 and PPD2 are not found in grasses. Overexpression of PPD reduces lamina size by promoting the early arrest of dispersed meristematic cells DMC proliferation during leaf and silique development. Deletion of the PPD locus increases leaf lamina size and results in dome-shaped rather than flat leaves. Siliques are also altered in shape because of extra lamina growth. The curvature of a deltappd leaf reflects the difference between excess growth of the lamina and a limitation to the extension capacity of its perimeter.
Uniprot Description
Regulates the arrest of dispersed meristematic cells during lamina development.
Research Articles on TIFY4A
Similar Products
Product Notes
The TIFY4A tify4a (Catalog #AAA1440594) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-313, Full length protein. The amino acid sequence is listed below: MDVGVSPAKS ILAKPLKLLT EEDISQLTRE DCRKFLKDKG MRRPSWNKSQ AIQQVLSLKA LYEPGDDSGA GIFRKILVSQ PVNPPRVTTT LIEPSNELEA CGRVSYPEDN GACHRMDSPR SAEFSGGSGH FVSEKDGHKT TISPRSPAET SELVGQMTIF YSGKVNVYDG IPPEKARSIM HFAANPIDLP ENGIFASSRM ISKLISKEKM MELPQKGLEK ANSSRDSGME GQANRKVSLQ RYREKRKDRK FSKAKKCPGV ASSSLEMFLN CQPRMKAAYS QNLGCTGSPL HSQSPESQTK SPNLSVDLNS EGI. It is sometimes possible for the material contained within the vial of "Protein TIFY 4A (TIFY4A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
