Thymidylate synthase (thyA) Recombinant Protein | thyA recombinant protein

Recombinant Mycoplasma pulmonis Thymidylate synthase (thyA)

Purity

Greater or equal to 85% purity as determined by SDS-PAGE.

Synonyms

Thymidylate synthase (thyA); Recombinant Mycoplasma pulmonis Thymidylate synthase (thyA); thyA recombinant protein

Ordering
Cat. Num. AAA1482429 When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures. For Research Use Only!

Host

E Coli or Yeast or Baculovirus or Mammalian Cell

Purity/Purification

Greater or equal to 85% purity as determined by SDS-PAGE.

Form/Format

Lyophilized or liquid (Format to be determined during the manufacturing process)

Sequence Positions

1-286, full length protein

Sequence

MKQYLDFLKWVLEKGKHKENRTSVDTISAFGYQMRFDLSKGFPLVTTKKTNFSAIAHELLWFIKGDTNIKYLVDNKVNIWNQWPYESYKKSQDFQSESLKEFIQKIKDDNEFAQKHGNLGPVYGKQWRDFLGIDQLKKVIEQIKNNPNSRRLIVSSWNPSEIDTMLLPPCHTLFQFYVNDNKLSCHLYQRSADAFLGIPFNIASYALLTFLLAQETNLEVGDFVHSIGDAHIYVNHLEQVKTQLKRNPKELPKLIIKNKNIFEINFEDIELVDYEFDPIIKGEVAV

Sequence Length

286

Species

Mycoplasma pulmonis (strain UAB CTIP)

Preparation and Storage

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #

499227799

NCBI Accession #

WP_010925339.1

NCBI GenBank Nucleotide #

WP_010925339.1

UniProt Accession #

Q98Q31

Molecular Weight

33,458 Da

NCBI Official Full Name

thymidylate synthase

UniProt Protein Name

Thymidylate synthase

Protein Family

Thymidylate synthase

UniProt Gene Name

thyA

UniProt Synonym Gene Names

TS; TSase

Uniprot Description

Catalyzes the reductive methylation of 2'-deoxyuridine-5'-monophosphate (dUMP) to 2'-deoxythymidine-5'-monophosphate (dTMP) while utilizing 5,10-methylenetetrahydrofolate (mTHF) as the methyl donor and reductant in the reaction, yielding dihydrofolate (DHF) as a by-product. This enzymatic reaction provides an intracellular de novo source of dTMP, an essential precursor for DNA biosynthesis.

Similar Products

Product Notes

The thyA thya (Catalog #AAA1482429) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-286, full length protein. The amino acid sequence is listed below: MKQYLDFLKW VLEKGKHKEN RTSVDTISAF GYQMRFDLSK GFPLVTTKKT NFSAIAHELL WFIKGDTNIK YLVDNKVNIW NQWPYESYKK SQDFQSESLK EFIQKIKDDN EFAQKHGNLG PVYGKQWRDF LGIDQLKKVI EQIKNNPNSR RLIVSSWNPS EIDTMLLPPC HTLFQFYVND NKLSCHLYQR SADAFLGIPF NIASYALLTF LLAQETNLEV GDFVHSIGDA HIYVNHLEQV KTQLKRNPKE LPKLIIKNKN IFEINFEDIE LVDYEFDPII KGEVAV. It is sometimes possible for the material contained within the vial of "Thymidylate synthase (thyA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Loading...