Thrombopoietin (Thpo) Recombinant Protein | Thpo recombinant protein
Recombinant Rat Thrombopoietin (Thpo)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Thrombopoietin (Thpo); Recombinant Rat Thrombopoietin (Thpo); Thpo recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-326, Full length protein
Sequence
SPVPPACDPRLLNKLLRDSYLLHSRLSQCPDVNPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPPQGRTTAHKDPSALFLSLQQLLRGKVRFLLLVEGPALCVRRTLPTTAVPSRTSQLLTLNKFPNRTSGLLETNFSVVARTAGPGLLNRLQGFRAKIIPGQLNQTSGSLDQIPGYLNGTHEPVNGTHGLFAGTSLQTLEAPDVVPGAFNKGSLPLNLQSGLPPIPSLAADGYTLFPPSPTFPTPGSPPQLPPVS
Sequence Length
305
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Thpo recombinant protein
Megakaryocytopoiesis is the cellular development process that leads to platelet production. This protein is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP
C_MPL, the product of myeloproliferative leukemia virus oncogene.
C_MPL, the product of myeloproliferative leukemia virus oncogene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,556 Da
NCBI Official Full Name
thrombopoietin
NCBI Official Synonym Full Names
thrombopoietin
NCBI Official Symbol
Thpo
NCBI Protein Information
thrombopoietin
UniProt Protein Name
Thrombopoietin
Protein Family
UniProt Gene Name
Thpo
NCBI Description
lineage-specific cytokine; important for proliferation and development of megakaryocytes and platelets; may be the major regulator of circulating platelets [RGD, Feb 2006]
Uniprot Description
Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets.
Research Articles on Thpo
Similar Products
Product Notes
The Thpo thpo (Catalog #AAA962655) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-326, Full length protein. The amino acid sequence is listed below: SPVPPACDPR LLNKLLRDSY LLHSRLSQCP DVNPLSIPVL LPAVDFSLGE WKTQTEQSKA QDILGAVSLL LEGVMAARGQ LEPSCLSSLL GQLSGQVRLL LGALQGLLGT QLPPQGRTTA HKDPSALFLS LQQLLRGKVR FLLLVEGPAL CVRRTLPTTA VPSRTSQLLT LNKFPNRTSG LLETNFSVVA RTAGPGLLNR LQGFRAKIIP GQLNQTSGSL DQIPGYLNGT HEPVNGTHGL FAGTSLQTLE APDVVPGAFN KGSLPLNLQS GLPPIPSLAA DGYTLFPPSP TFPTPGSPPQ LPPVS. It is sometimes possible for the material contained within the vial of "Thrombopoietin (Thpo), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
